Bos taurus (cow): 613349 Help Entry 613349            CDS       T01008                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism bta  Bos taurus (cow) Pathway bta04145   Phagocytosis bta04814   Motor proteins bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     613349 (DYNLT3)   09142 Cell motility    04814 Motor proteins     613349 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     613349 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     613349 (DYNLT3)    04812 Cytoskeleton proteins [BR:bta04812]     613349 (DYNLT3) Cilium and associated proteins [BR:bta03037]  Motile cilia and associated proteins   Dynein arm    613349 (DYNLT3) Cytoskeleton proteins [BR:bta04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      613349 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  613349 NCBI-ProteinID:  NP_001094690 BGD-bta:  BT15753 Ensembl:  ENSBTAG00000038156 VGNC:  28278 UniProt:  A0ACM8QDH4 A6QLR8 LinkDB All DBs Position X Genome browser AA seq 116 aa AA seqDB search MEEYHRPCDEVGFNADEAHNIVKECIDGVLGGEDYNQNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgcccctgcgacgaggttggcttcaatgctgatgaagcccacaat attgttaaagagtgtatagatggggtcttgggaggtgaagattataatcagaacaatatc aaccaatggactgcaagcatagtggaacaatccctggcacatctggttaagttgggaaaa gcttataagtatattgtgacctgtgcagtggtccagaggagtccatatggctttcacaca gccagctcatgtttttgggacaccacatctgatggaacctgcactgtaagatgggagaac cgaaccatgaactgtatcgtcaatgtttttgccattgctattgtcctgtag

DBGET integrated database retrieval system