Bos taurus (cow): 614551 Help Entry 614551            CDS       T01008                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism bta  Bos taurus (cow) Brite KEGG Orthology (KO) [BR:bta00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:bta03041]     614551 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     614551 (UBL5) Spliceosome [BR:bta03041]  Complex B   Other components    Complex B specific factors     614551 (UBL5) Cytokines and neuropeptides [BR:bta04052]  Neuropeptides   Unclassified    614551 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  614551 NCBI-ProteinID:  NP_001032799 BGD-bta:  BT16055 Ensembl:  ENSBTAG00000049452 UniProt:  Q3T0Z3 LinkDB All DBs Position 7:14420687..14422238 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctgggaaagaaggtgcgcgttaagtgcaatacg gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtattgaagaagtggtacacgatttttaaggaccatgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system