Bos taurus (cow): 615091 Help Entry 615091            CDS       T01008                                  Symbol H2BC18 Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05203   Viral carcinogenesis bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     615091 (H2BC18)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     615091 (H2BC18)   09163 Immune disease    05322 Systemic lupus erythematosus     615091 (H2BC18)   09165 Substance dependence    05034 Alcoholism     615091 (H2BC18)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     615091 (H2BC18)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     615091 (H2BC18) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     615091 (H2BC18) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    615091 (H2BC18) SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  615091 NCBI-ProteinID:  XP_010801389 BGD-bta:  BT25844 Ensembl:  ENSBTAG00000032455 VGNC:  83596 LinkDB All DBs Position 3:20779391..20779989 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctccaaaaaaaggttctaaaaaggctgtcacg aaagtgcagaagaaggatggtaagaagcgcaagcgcagccgcaaggagagctattccgtt tacgtgtataaggtgctgaaacaggtacacccggacaccggcatctcgtccaaggccatg ggcatcatgaattctttcgtcaatgacattttcgagcgcattgccggcgaagcatcgcgc ctggcgcattacaacaagcgctcgaccattacttcccgagagatccagacagcggtacgc ctgctgcttcccggcgagctggctaaacacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagttcaaagtaa

DBGET integrated database retrieval system