Bos taurus (cow): 616627 Help Entry 616627            CDS       T01008                                  Symbol H2BC12 Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05203   Viral carcinogenesis bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     616627 (H2BC12)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     616627 (H2BC12)   09163 Immune disease    05322 Systemic lupus erythematosus     616627 (H2BC12)   09165 Substance dependence    05034 Alcoholism     616627 (H2BC12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     616627 (H2BC12)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     616627 (H2BC12) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     616627 (H2BC12) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    616627 (H2BC12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  616627 NCBI-ProteinID:  NP_001071531 Ensembl:  ENSBTAG00000038173 VGNC:  83582 UniProt:  Q2M2T1 Structure PDBPDBj LinkDB All DBs Position 23:31354601..31355276 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKIDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagaaccagcgaagtccgctccggccccgaaaaagggctccaagaaggcggtcacc aaggcgcaaaagatagacggcaagaagcgcaagcgtagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggctatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcattgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacatccagggagatccagacggccgtgcgc ctactgctgcccggggagctggccaagcatgcggtgtctgagggtaccaaggccgtcacc aagtacaccagcgccaagtaa

DBGET integrated database retrieval system