Bos taurus (cow): 616800 Help Entry 616800            CDS       T01008                                  Symbol H3C12 Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05202   Transcriptional misregulation in cancer bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     616800 (H3C12)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     616800 (H3C12)   09163 Immune disease    05322 Systemic lupus erythematosus     616800 (H3C12)   09165 Substance dependence    05034 Alcoholism     616800 (H3C12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     616800 (H3C12)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     616800 (H3C12) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     616800 (H3C12) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    616800 (H3C12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  616800 NCBI-ProteinID:  XP_002697506 BGD-bta:  BT21609 VGNC:  83594 UniProt:  P68432 LinkDB All DBs Position 23:30950687..30951191 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagacggctcgcaagtccactggcggcaaggcgccgcgcaaacag ctcgccaccaaggcggctcgcaagagcgctccggccactggcggcgtgaagaagccgcac cgctaccggcccggcacggtagctctgcgcgagattcgccgttaccagaagtccacggag ctgctgatccgcaagctgcctttccagcggctggtacgcgagatcgcgcaggacttcaag accgacctgcgtttccagagctcggcagtgatggcgctgcaggaggcgtgcgaggcctat ctggtggggctcttcgaagacaccaacctgtgtgccatccacgccaagcgcgtcactatc atgcccaaggacatccagcttgctcgccgcatccgcggggagagggcataa

DBGET integrated database retrieval system