Bos taurus (cow): 616868 Help Entry 616868            CDS       T01008                                  Symbol H2BC14 Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05203   Viral carcinogenesis bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     616868 (H2BC14)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     616868 (H2BC14)   09163 Immune disease    05322 Systemic lupus erythematosus     616868 (H2BC14)   09165 Substance dependence    05034 Alcoholism     616868 (H2BC14)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     616868 (H2BC14)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     616868 (H2BC14) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     616868 (H2BC14) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    616868 (H2BC14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  616868 NCBI-ProteinID:  XP_024839707 BGD-bta:  BT29632 VGNC:  83583 UniProt:  P62808 LinkDB All DBs Position 23:complement(30995190..30995680) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagcgaagtccgctcctgccccgaagaagggttctaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggaatcatgaactccttcgtcaacgatatcttcgagcgcatcgctggcgaggcgtcgcgc ctggcgcattacaacaagcgttcgaccatcacatccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aaatacaccagctccaagtaa

DBGET integrated database retrieval system