Bos taurus (cow): 617277 Help Entry 617277            CDS       T01008                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bta  Bos taurus (cow) Pathway bta04066   HIF-1 signaling pathway bta04120   Ubiquitin mediated proteolysis bta05170   Human immunodeficiency virus 1 infection bta05200   Pathways in cancer bta05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     617277 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     617277 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     617277 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     617277 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     617277 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bta04121]     617277 (ELOB)    03400 DNA repair and recombination proteins [BR:bta03400]     617277 (ELOB) Ubiquitin system [BR:bta04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      617277 (ELOB)    Cul5 complex      617277 (ELOB) DNA repair and recombination proteins [BR:bta03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      617277 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  617277 NCBI-ProteinID:  NP_001029972 BGD-bta:  BT28945 Ensembl:  ENSBTAG00000019543 UniProt:  Q3SZ32 LinkDB All DBs Position 25 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccattttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggtatcctcaagcggccgccggat gagcagcggctgtacaaggacgaccagcttctggatgacggcaagacgttgggcgagtgt ggcttcaccagccagacagcacggcctcaggcccccgccactgtggggctagccttcagg gcagatgaggcattcgaggccctgcgcatcgagcctttctctagcccacctgagctgccg gacgtgatgaagccacaggactcaggaagcagcgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system