Bos taurus (cow): 617449 Help Entry 617449            CDS       T01008                                  Symbol CLDN9 Name (RefSeq) claudin-9   KO K06087   claudin Organism bta  Bos taurus (cow) Pathway bta03272   Virion - Hepatitis viruses bta04382   Cornified envelope formation bta04514   Cell adhesion molecule (CAM) interaction bta04530   Tight junction bta04670   Leukocyte transendothelial migration bta05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     617449 (CLDN9)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     617449 (CLDN9)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     617449 (CLDN9)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     617449 (CLDN9)   09158 Development and regeneration    04382 Cornified envelope formation     617449 (CLDN9)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     617449 (CLDN9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     617449 (CLDN9)    04147 Exosome [BR:bta04147]     617449 (CLDN9) Cilium and associated proteins [BR:bta03037]  Other cilia and associated proteins   Stereociliary proteins    617449 (CLDN9) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    617449 (CLDN9)   Exosomal proteins of colorectal cancer cells    617449 (CLDN9) SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM_230_134 CdpA_N Motif Other DBs NCBI-GeneID:  617449 NCBI-ProteinID:  XP_002697981 BGD-bta:  BT23488 Ensembl:  ENSBTAG00000047563 VGNC:  27420 UniProt:  A0AAA9TEZ5 LinkDB All DBs Position 25 Genome browser AA seq 217 aa AA seqDB search MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG QMQCKVYDSLLALPQDLQAARALCVIALLLALLGVLVAITGAQCTTCVEDEGAKARIVLT AGVLLLLAGILVLIPVCWTAHAIIQDFYNPMVAEALKRELGASLYLGWAASALLLLGGGL LCCTCPPPQIERPQGQRLGYSIPSRSGASGLDKRDYV NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggcttccactggccttgaactcctgggtatgaccctggctgtgctgggctggctgggg accctggtgtcctgcgccctgcccctgtggaaggtgaccgccttcatcggcaatagcatc gtggtggcccaggtggtgtgggaggggctgtggatgtcctgcgtggtgcagagcacgggc cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggccgcc cgggccctctgcgtcatcgccctcctgctggccctgctcggagtgctggtggccatcacg ggcgcccagtgcaccacctgcgtggaggacgaaggagccaaggcccgcatcgtgctcacc gcgggagtcctcctcctccttgcgggcatcctggtgctcatccccgtgtgctggacggcc cacgccatcatccaggacttctacaaccccatggtggccgaggccctcaagcgtgagctg ggagcctccctctacctgggctgggccgcgtccgcccttcttctgctgggaggggggcta ctgtgttgcacgtgccccccgcctcagatcgagcggccccagggacagaggctgggctac tctatcccctcccgctcgggggcatctgggctggacaagagggactacgtgtga

DBGET integrated database retrieval system