Bos taurus (cow): 617585 Help Entry 617585            CDS       T01008                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism bta  Bos taurus (cow) Pathway bta04010   MAPK signaling pathway bta04020   Calcium signaling pathway bta04022   cGMP-PKG signaling pathway bta04114   Oocyte meiosis bta04218   Cellular senescence bta04310   Wnt signaling pathway bta04360   Axon guidance bta04370   VEGF signaling pathway bta04380   Osteoclast differentiation bta04625   C-type lectin receptor signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04658   Th1 and Th2 cell differentiation bta04659   Th17 cell differentiation bta04660   T cell receptor signaling pathway bta04662   B cell receptor signaling pathway bta04720   Long-term potentiation bta04724   Glutamatergic synapse bta04921   Oxytocin signaling pathway bta04922   Glucagon signaling pathway bta04924   Renin secretion bta05010   Alzheimer disease bta05014   Amyotrophic lateral sclerosis bta05020   Prion disease bta05022   Pathways of neurodegeneration - multiple diseases bta05031   Amphetamine addiction bta05152   Tuberculosis bta05163   Human cytomegalovirus infection bta05166   Human T-cell leukemia virus 1 infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05170   Human immunodeficiency virus 1 infection bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     617585 (PPP3R2)    04310 Wnt signaling pathway     617585 (PPP3R2)    04370 VEGF signaling pathway     617585 (PPP3R2)    04020 Calcium signaling pathway     617585 (PPP3R2)    04022 cGMP-PKG signaling pathway     617585 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     617585 (PPP3R2)    04218 Cellular senescence     617585 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     617585 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     617585 (PPP3R2)    04660 T cell receptor signaling pathway     617585 (PPP3R2)    04658 Th1 and Th2 cell differentiation     617585 (PPP3R2)    04659 Th17 cell differentiation     617585 (PPP3R2)    04662 B cell receptor signaling pathway     617585 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     617585 (PPP3R2)    04921 Oxytocin signaling pathway     617585 (PPP3R2)    04924 Renin secretion     617585 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     617585 (PPP3R2)    04720 Long-term potentiation     617585 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     617585 (PPP3R2)    04380 Osteoclast differentiation     617585 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     617585 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     617585 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     617585 (PPP3R2)    05163 Human cytomegalovirus infection     617585 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     617585 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     617585 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     617585 (PPP3R2)    05014 Amyotrophic lateral sclerosis     617585 (PPP3R2)    05020 Prion disease     617585 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     617585 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     617585 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     617585 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bta01009]     617585 (PPP3R2) Protein phosphatases and associated proteins [BR:bta01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      617585 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Toprim_3 Motif Other DBs NCBI-GeneID:  617585 NCBI-ProteinID:  NP_001073099 UniProt:  Q2TBI5 LinkDB All DBs Position 8:complement(91335467..91336369) Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQENPLVQRVID VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEIHKHLVTIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggcggagatatgctcgcacttcgacgaagatgaaatt aaaaggctgcgcaagcgttttaagaagctggacttggacagttccagcgctctgagcgtc aaagagttcacgtccatgccagagctgcaggagaacccgctggtgcagcgggtgatagac gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggta ggcgacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg gagatccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system