Bos taurus (cow): 618947 Help Entry 618947            CDS       T01008                                  Name (RefSeq) interferon alpha-B-like   KO K05414   interferon alpha Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04151   PI3K-Akt signaling pathway bta04217   Necroptosis bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04622   RIG-I-like receptor signaling pathway bta04623   Cytosolic DNA-sensing pathway bta04630   JAK-STAT signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04936   Alcoholic liver disease bta05152   Tuberculosis bta05160   Hepatitis C bta05161   Hepatitis B bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05165   Human papillomavirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05168   Herpes simplex virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05200   Pathways in cancer bta05320   Autoimmune thyroid disease bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     618947    04151 PI3K-Akt signaling pathway     618947   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     618947  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     618947  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     618947    04621 NOD-like receptor signaling pathway     618947    04622 RIG-I-like receptor signaling pathway     618947    04623 Cytosolic DNA-sensing pathway     618947    04650 Natural killer cell mediated cytotoxicity     618947  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     618947   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     618947    05161 Hepatitis B     618947    05160 Hepatitis C     618947    05171 Coronavirus disease - COVID-19     618947    05164 Influenza A     618947    05162 Measles     618947    05168 Herpes simplex virus 1 infection     618947    05163 Human cytomegalovirus infection     618947    05167 Kaposi sarcoma-associated herpesvirus infection     618947    05169 Epstein-Barr virus infection     618947    05165 Human papillomavirus infection     618947   09171 Infectious disease: bacterial    05152 Tuberculosis     618947   09163 Immune disease    05320 Autoimmune thyroid disease     618947   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     618947   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     618947  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     618947 Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interferons    618947 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon DUF4381 Motif Other DBs NCBI-GeneID:  618947 NCBI-ProteinID:  XP_002689560 BGD-bta:  BT29501 Ensembl:  ENSBTAG00000048891 UniProt:  A0A7R8GV25 LinkDB All DBs Position 8:complement(22782600..22783404) Genome browser AA seq 228 aa AA seqDB search METMGSYLRHRPEGRSSENLESRFRVTHLPRPQASARSPMAPAWSLLLALLLLSCNATCS LGCHLPHTHSLPNRRVLMLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLH EVTQHTFQLFSTEGSAAVWDKSLLDKLHAALDQQLTDLQACLRQEEGLRGAPLLNEDSSL AVRKYFHRLTVYLQEKRHSPCAWEVVRAQIMRAFSSSTNLQERFRRKD NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggaaaccatgggctcctacttaagacacaggcctgaaggaaggtcttcagagaatcta gagagcaggttcagagtcacccacctccccaggccacaagcatctgcaaggtccccgatg gccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccacctgctct ctgggctgccacctgcctcacacccacagcctgcccaacaggagggtcctgatgctcctg agacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgcattc ccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctccac gaggtgacccagcacaccttccagcttttcagcacagagggctcggccgctgtgtgggac aagagcctcctggacaagctccatgctgcactggatcagcagctcactgacctgcaagcc tgtctgaggcaggaggaggggctgcgaggggctcccctactcaacgaggactccagcctg gctgtgaggaaatacttccacagactcactgtctatctgcaagagaagagacacagccct tgtgcctgggaggttgtcagagcacaaatcatgagagccttctcttcctcaaccaacttg caggagagattcaggagaaaggactga

DBGET integrated database retrieval system