Bos taurus (cow): 751828 Help Entry 751828            CDS       T01008                                  Symbol UCN2 Name (RefSeq) urocortin-2   KO K05257   urocortin 2/3 Organism bta  Bos taurus (cow) Pathway bta04080   Neuroactive ligand-receptor interaction bta04081   Hormone signaling Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     751828 (UCN2)    04081 Hormone signaling     751828 (UCN2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     751828 (UCN2) Cytokines and neuropeptides [BR:bta04052]  Neuropeptides   GPCR binding    751828 (UCN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CRF DUF1152 Motif Other DBs NCBI-GeneID:  751828 NCBI-ProteinID:  XP_024839044 BGD-bta:  BT12474 Ensembl:  ENSBTAG00000019078 VGNC:  36638 UniProt:  F1MKP4 LinkDB All DBs Position 22:51317807..51319310 Genome browser AA seq 112 aa AA seqDB search MTRWALLTLMVLTLGRTLLVPATPTPGFQLLPQNFPQATACPVTSESPSGSTTAPSAAWG RPSPDPHPGPRITLSLDVPLGLLQILLEQARARAVREQAAANARILAQVGRR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgaccaggtgggctctgctcacgctgatggtcctgacattgggcaggaccctgcttgtc ccagcaacccccaccccaggcttccagctcctccctcagaactttccccaggccactgcc tgccccgtgacctcggagagcccctcaggcagcaccacggcaccctccgctgcttggggt cgccccagccctgacccccaccctggcccccgcatcaccctctcgctggacgtccccctt ggcctcctgcagatcttactggagcaggcccgggccagggctgtgagggagcaggctgct gccaatgcccgcatcctggcccaggtcggccgccgctga

DBGET integrated database retrieval system