Bos taurus (cow): 777644 Help Entry 777644            CDS       T01008                                  Symbol GSTA1 Name (RefSeq) glutathione S-transferase A1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism bta  Bos taurus (cow) Pathway bta00480   Glutathione metabolism bta00980   Metabolism of xenobiotics by cytochrome P450 bta00982   Drug metabolism - cytochrome P450 bta00983   Drug metabolism - other enzymes bta01100   Metabolic pathways bta01524   Platinum drug resistance bta05200   Pathways in cancer bta05204   Chemical carcinogenesis - DNA adducts bta05207   Chemical carcinogenesis - receptor activation bta05208   Chemical carcinogenesis - reactive oxygen species bta05225   Hepatocellular carcinoma bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     777644 (GSTA1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     777644 (GSTA1)    00982 Drug metabolism - cytochrome P450     777644 (GSTA1)    00983 Drug metabolism - other enzymes     777644 (GSTA1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     777644 (GSTA1)    05204 Chemical carcinogenesis - DNA adducts     777644 (GSTA1)    05207 Chemical carcinogenesis - receptor activation     777644 (GSTA1)    05208 Chemical carcinogenesis - reactive oxygen species     777644 (GSTA1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     777644 (GSTA1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     777644 (GSTA1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     777644 (GSTA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bta02000]     777644 (GSTA1) Enzymes [BR:bta01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      777644 (GSTA1) Transporters [BR:bta02000]  Other transporters   Pores ion channels [TC:1]    777644 (GSTA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  777644 NCBI-ProteinID:  NP_001071617 Ensembl:  ENSBTAG00000021516 UniProt:  Q28035 LinkDB All DBs Position 23:complement(25122370..25137232) Genome browser AA seq 222 aa AA seqDB search MAGKPTLHYFNGRGRMECIRWLLAAAGVEFEEKFIEKPEDLDKLKNDGSLMFQQVPMVEI DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVADLGEMIMHFPLCPPAEKDAK LTLIREKTTNRYLPAFENVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPSLLANFPL LKALKARVSNIPAVKKFLQPGSQRKPPTDEKKIEEARKVFKF NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagggaagcccactcttcactatttcaatggacgcggcagaatggagtgcattcgg tggctcctagctgcagctggagtggagtttgaagagaaatttatagaaaaaccagaagac ttggataagttaaaaaatgatgggagtttgatgttccagcaagtgccaatggttgaaatt gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac ctctacgggaaagacatgaaggagagagccctgattgatatgtattcagagggtgtggca gatttgggtgaaatgatcatgcattttccactgtgcccacctgctgaaaaagatgccaag ctgaccctaatccgagaaaagacaacaaaccgttatctccctgcatttgaaaatgtgctg aagagccatggacaagactacctggtgggcaacaagctgagcagggctgacatccacttg gttgaacttctctactatgtggaagagctggaccccagccttttggccaacttccctctg ctaaaggccctaaaagccagagtcagcaatatcccggccgtgaagaaatttctgcagcct ggcagccagaggaagcctcccacggatgagaaaaaaatagaagaagccaggaaggttttc aagttttag

DBGET integrated database retrieval system