Bemisia tabaci (sweet potato whitefly): 109033741 Help Entry 109033741         CDS       T06019                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism btab  Bemisia tabaci (sweet potato whitefly) Pathway btab04137   Mitophagy - animal btab04140   Autophagy - animal btab04144   Endocytosis btab04145   Phagosome btab04148   Efferocytosis Brite KEGG Orthology (KO) [BR:btab00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109033741    04145 Phagosome     109033741    04140 Autophagy - animal     109033741    04137 Mitophagy - animal     109033741    04148 Efferocytosis     109033741  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btab04131]     109033741   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btab04147]     109033741    04031 GTP-binding proteins [BR:btab04031]     109033741 Membrane trafficking [BR:btab04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109033741 Exosome [BR:btab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109033741   Exosomal proteins of other body fluids (saliva and urine)    109033741   Exosomal proteins of colorectal cancer cells    109033741   Exosomal proteins of bladder cancer cells    109033741 GTP-binding proteins [BR:btab04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109033741 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA ATP_bind_1 RsgA_GTPase cobW Septin PduV-EutP nSTAND3 G-alpha AAA_5 ATPase_2 AAA_22 NTPase_1 AAA_7 AAA_16 ATP-synt_ab AAA_24 NACHT AAA_14 AIG1 NB-ARC Motif Other DBs NCBI-GeneID:  109033741 NCBI-ProteinID:  XP_018902043 UniProt:  A0A9P0F0V4 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MASRRKLLLKIIILGDSGVGKTALMNQYVNKKFSNQYKATIGADFLTKEVMVDNRIVTLQ IWDTAGQERFQSLGVAFYRGADGCILVFDTTSMNSFASLDAWRDEFLIQSSPKNTENFPF VVLGNKIDLENRAVSTKRAQKWCQTKNNIPYFETSAKEAVNVEQAFETIAKSAIALEKEE IYNDFPGDIILDRDNKPNNGAACNC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcatcaagaaggaagctcctcctcaaaattatcatccttggtgactcaggtgttggt aagacagctttgatgaaccagtatgtcaacaaaaaattctccaaccagtacaaagccaca atcggagctgattttctaacgaaagaagtcatggttgataatcgaatcgtcactcttcag atttgggacacagctggtcaagagaggtttcagtcgttgggtgtggcattttaccgagga gctgatggctgtattctcgttttcgatacaacttcaatgaacagttttgcatccttagat gcatggcgagatgaattcctcattcagtcttcaccaaagaatacggagaacttcccgttc gtagttctagggaacaaaatcgatttagaaaacagagcagtttcaacgaagcgagcgcaa aaatggtgccaaacaaagaacaacatcccttactttgaaactagtgctaaagaagctgtc aacgtagaacaagccttcgaaactattgccaaaagcgccattgctctcgaaaaggaagag atctacaatgacttccctggcgatatcatccttgatagagataataaaccgaataatggc gcagcttgtaattgttaa

DBGET integrated database retrieval system