Bemisia tabaci (sweet potato whitefly): 109037334 Help Entry 109037334         CDS       T06019                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism btab  Bemisia tabaci (sweet potato whitefly) Pathway btab04144   Endocytosis btab04517   IgSF CAM signaling btab04518   Integrin signaling btab04519   Cadherin signaling btab05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:btab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     109037334    04518 Integrin signaling     109037334    04519 Cadherin signaling     109037334  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109037334  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109037334  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btab04131]     109037334    03036 Chromosome and associated proteins [BR:btab03036]     109037334   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btab04147]     109037334    04031 GTP-binding proteins [BR:btab04031]     109037334 Membrane trafficking [BR:btab04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109037334  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     109037334   Macropinocytosis    Ras GTPases     109037334 Chromosome and associated proteins [BR:btab03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     109037334 Exosome [BR:btab04147]  Exosomal proteins   Exosomal proteins of microglial cells    109037334   Exosomal proteins of breast milk    109037334 GTP-binding proteins [BR:btab04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109037334 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  109037334 NCBI-ProteinID:  XP_018907478 UniProt:  A0A9P0AF55 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPKTPFLLVGTQIDLR EDAGTIEKLAKNKQKPISFEQGEKLTKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVKKRKCCIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactatcaagtgtgttgtcgttggagatggtgctgtaggtaaaacctgcctctta atatcatacacaaccaacaaatttccatcagaatatgtgccaactgtatttgataactat gcagtcacagtaatgatcggtggggaaccttacactttaggactatttgatactgcaggt caagaggattatgacagattaaggcctcttagttatccgcagacagatgtttttctagtg tgtttttcagtcgtgtctccctcatcatttgaaaatgtcaaagaaaagtgggtgccagaa atttcacatcactgtccaaaaacaccatttcttcttgttggaactcaaatcgatttgaga gaagatgccggaaccatcgaaaaacttgcgaagaataagcagaaacccatatcattcgag cagggagagaaactgactaaagaactcaaagctgtaaaatatgttgaatgttcagcatta acacagaaaggattaaagaatgttttcgatgaagcaatattggcagcgttggaacctcca gaacctgttaagaaaagaaagtgttgtatactttga

DBGET integrated database retrieval system