Bemisia tabaci (sweet potato whitefly): 109038771
Help
Entry
109038771 CDS
T06019
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
btab
Bemisia tabaci (sweet potato whitefly)
Brite
KEGG Orthology (KO) [BR:
btab00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
btab03029
]
109038771
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
btab02000
]
109038771
Mitochondrial biogenesis [BR:
btab03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
109038771
Transporters [BR:
btab02000
]
Other transporters
Primary active transporters [TC:
3
]
109038771
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
109038771
NCBI-ProteinID:
XP_018909503
UniProt:
A0A9P0F914
LinkDB
All DBs
Position
Unknown
AA seq
165 aa
AA seq
DB search
MEEYAREPCPWRIVDDCGGAFTMGAIGGALFQGIKGFRNAPSGMSRRFAGSLAAVKQRSP
ILAGNFAVWGGVFSSIDCTLVYLRHKEDPWNSIISGAATGGILAARNGVPAMAGSALIGG
VLLALIEGVGILFTRLTAEQFRQHGPFEDPASLGFPGGGNPQNYQ
NT seq
498 nt
NT seq
+upstream
nt +downstream
nt
atggaagagtatgcccgagaaccttgtccgtggagaattgttgatgactgtggtggagct
ttcacaatgggcgctattggaggtgctctatttcaaggaatcaaaggatttagaaatgcc
ccaagtggaatgtccagaagatttgctggaagtctggcagcagtgaaacaaagatcacca
attctagccggaaattttgcggtttggggtggagtgttttcatcaatagattgcacttta
gtttacttaagacataaagaggatccatggaattccataatcagtggagcagccacaggg
ggtatactcgctgcacgaaacggtgtaccggcaatggcaggcagcgcgttgattggcggc
gttcttttagctcttattgaaggtgtaggtattctattcacaaggctgacagcagaacaa
tttcgacagcacggcccattcgaagacccagcctcacttggttttcctggcggcgggaac
ccacagaactatcagtga
DBGET
integrated database retrieval system