KEGG   Budorcas taxicolor (takin): 128043471
Entry
128043471         CDS       T08909                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
btax  Budorcas taxicolor (takin)
Pathway
btax04010  MAPK signaling pathway
btax04014  Ras signaling pathway
btax04015  Rap1 signaling pathway
btax04024  cAMP signaling pathway
btax04062  Chemokine signaling pathway
btax04071  Sphingolipid signaling pathway
btax04145  Phagosome
btax04148  Efferocytosis
btax04151  PI3K-Akt signaling pathway
btax04310  Wnt signaling pathway
btax04360  Axon guidance
btax04370  VEGF signaling pathway
btax04380  Osteoclast differentiation
btax04510  Focal adhesion
btax04517  IgSF CAM signaling
btax04518  Integrin signaling
btax04519  Cadherin signaling
btax04520  Adherens junction
btax04530  Tight junction
btax04613  Neutrophil extracellular trap formation
btax04620  Toll-like receptor signaling pathway
btax04650  Natural killer cell mediated cytotoxicity
btax04662  B cell receptor signaling pathway
btax04664  Fc epsilon RI signaling pathway
btax04666  Fc gamma R-mediated phagosome formation
btax04670  Leukocyte transendothelial migration
btax04722  Neurotrophin signaling pathway
btax04810  Regulation of actin cytoskeleton
btax04932  Non-alcoholic fatty liver disease
btax04933  AGE-RAGE signaling pathway in diabetic complications
btax04972  Pancreatic secretion
btax05014  Amyotrophic lateral sclerosis
btax05020  Prion disease
btax05022  Pathways of neurodegeneration - multiple diseases
btax05100  Bacterial invasion of epithelial cells
btax05132  Salmonella infection
btax05135  Yersinia infection
btax05163  Human cytomegalovirus infection
btax05167  Kaposi sarcoma-associated herpesvirus infection
btax05169  Epstein-Barr virus infection
btax05170  Human immunodeficiency virus 1 infection
btax05200  Pathways in cancer
btax05203  Viral carcinogenesis
btax05205  Proteoglycans in cancer
btax05208  Chemical carcinogenesis - reactive oxygen species
btax05210  Colorectal cancer
btax05211  Renal cell carcinoma
btax05212  Pancreatic cancer
btax05231  Choline metabolism in cancer
btax05415  Diabetic cardiomyopathy
btax05416  Viral myocarditis
btax05417  Lipid and atherosclerosis
btax05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:btax00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    128043471 (RAC1)
   04014 Ras signaling pathway
    128043471 (RAC1)
   04015 Rap1 signaling pathway
    128043471 (RAC1)
   04310 Wnt signaling pathway
    128043471 (RAC1)
   04370 VEGF signaling pathway
    128043471 (RAC1)
   04071 Sphingolipid signaling pathway
    128043471 (RAC1)
   04024 cAMP signaling pathway
    128043471 (RAC1)
   04151 PI3K-Akt signaling pathway
    128043471 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    128043471 (RAC1)
   04518 Integrin signaling
    128043471 (RAC1)
   04519 Cadherin signaling
    128043471 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    128043471 (RAC1)
   04148 Efferocytosis
    128043471 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    128043471 (RAC1)
   04520 Adherens junction
    128043471 (RAC1)
   04530 Tight junction
    128043471 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    128043471 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    128043471 (RAC1)
   04620 Toll-like receptor signaling pathway
    128043471 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    128043471 (RAC1)
   04662 B cell receptor signaling pathway
    128043471 (RAC1)
   04664 Fc epsilon RI signaling pathway
    128043471 (RAC1)
   04666 Fc gamma R-mediated phagosome formation
    128043471 (RAC1)
   04670 Leukocyte transendothelial migration
    128043471 (RAC1)
   04062 Chemokine signaling pathway
    128043471 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    128043471 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    128043471 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    128043471 (RAC1)
   04380 Osteoclast differentiation
    128043471 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    128043471 (RAC1)
   05205 Proteoglycans in cancer
    128043471 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    128043471 (RAC1)
   05203 Viral carcinogenesis
    128043471 (RAC1)
   05231 Choline metabolism in cancer
    128043471 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    128043471 (RAC1)
   05212 Pancreatic cancer
    128043471 (RAC1)
   05211 Renal cell carcinoma
    128043471 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    128043471 (RAC1)
   05163 Human cytomegalovirus infection
    128043471 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    128043471 (RAC1)
   05169 Epstein-Barr virus infection
    128043471 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    128043471 (RAC1)
   05135 Yersinia infection
    128043471 (RAC1)
   05100 Bacterial invasion of epithelial cells
    128043471 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    128043471 (RAC1)
   05020 Prion disease
    128043471 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    128043471 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    128043471 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    128043471 (RAC1)
   05415 Diabetic cardiomyopathy
    128043471 (RAC1)
   05416 Viral myocarditis
    128043471 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    128043471 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    128043471 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:btax04131]
    128043471 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btax04147]
    128043471 (RAC1)
   04031 GTP-binding proteins [BR:btax04031]
    128043471 (RAC1)
Membrane trafficking [BR:btax04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    128043471 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    128043471 (RAC1)
  Macropinocytosis
   Ras GTPases
    128043471 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    128043471 (RAC1)
Exosome [BR:btax04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128043471 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   128043471 (RAC1)
  Exosomal proteins of colorectal cancer cells
   128043471 (RAC1)
  Exosomal proteins of bladder cancer cells
   128043471 (RAC1)
GTP-binding proteins [BR:btax04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    128043471 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 128043471
NCBI-ProteinID: XP_052491781
LinkDB
Position
2:complement(4649784..4669730)
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtgggtaagacttgcctcctg
atcagttacactaccaatgcatttcctggagaatatatccccactgtctttgacaactac
tctgccaatgtcatggtggatggaaaacccgtgaatctgggcttgtgggacacagccgga
caagaagattatgaccgattacgccccctgtcctacccgcagacagatgtattcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacacacccatcatcctggtggggacgaaacttgacctgagg
gacgataaagatacgatcgagaagctgaaggagaagaagctgacgcccatcacctacccg
cagggcttggccatggccaaggagattggtgccgtcaaatacctggagtgctcggcgctc
acgcagcggggcctcaagacagtgtttgatgaggcgatccgggcggttctctgcccgccc
cccgtcaagaagcggaagaggaagtgcctgctcttgtga

DBGET integrated database retrieval system