Budorcas taxicolor (takin): 128043504 Help Entry 128043504         CDS       T08909                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism btax  Budorcas taxicolor (takin) Pathway btax04613   Neutrophil extracellular trap formation btax05034   Alcoholism btax05202   Transcriptional misregulation in cancer btax05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:btax00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     128043504  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     128043504   09163 Immune disease    05322 Systemic lupus erythematosus     128043504   09165 Substance dependence    05034 Alcoholism     128043504  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btax03036]     128043504   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128043504 Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128043504 Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128043504 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  128043504 NCBI-ProteinID:  XP_052491818 LinkDB All DBs Position 2:17152369..17152934 Genome browser AA seq 136 aa AA seqDB search MARTKRTARKSTGGKAPRKQLSTKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLICKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAINAKCVTV MPKDIQLARCIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcggactgcccggaaatcaaccggtggtaaagcaccgaggaagcaa ctctctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgatttgcaaacttcccttccagcgtctggtacgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctgttggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatcaatgccaaatgtgtaacagtt atgccaaaagacatccagctagcacgctgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system