Budorcas taxicolor (takin): 128044537 Help Entry 128044537         CDS       T08909                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism btax  Budorcas taxicolor (takin) Pathway btax01521   EGFR tyrosine kinase inhibitor resistance btax01522   Endocrine resistance btax04010   MAPK signaling pathway btax04012   ErbB signaling pathway btax04014   Ras signaling pathway btax04015   Rap1 signaling pathway btax04062   Chemokine signaling pathway btax04068   FoxO signaling pathway btax04071   Sphingolipid signaling pathway btax04072   Phospholipase D signaling pathway btax04137   Mitophagy - animal btax04140   Autophagy - animal btax04150   mTOR signaling pathway btax04151   PI3K-Akt signaling pathway btax04210   Apoptosis btax04211   Longevity regulating pathway btax04213   Longevity regulating pathway - multiple species btax04218   Cellular senescence btax04360   Axon guidance btax04370   VEGF signaling pathway btax04371   Apelin signaling pathway btax04540   Gap junction btax04550   Signaling pathways regulating pluripotency of stem cells btax04625   C-type lectin receptor signaling pathway btax04650   Natural killer cell mediated cytotoxicity btax04660   T cell receptor signaling pathway btax04662   B cell receptor signaling pathway btax04664   Fc epsilon RI signaling pathway btax04714   Thermogenesis btax04720   Long-term potentiation btax04722   Neurotrophin signaling pathway btax04725   Cholinergic synapse btax04726   Serotonergic synapse btax04730   Long-term depression btax04810   Regulation of actin cytoskeleton btax04910   Insulin signaling pathway btax04912   GnRH signaling pathway btax04915   Estrogen signaling pathway btax04916   Melanogenesis btax04917   Prolactin signaling pathway btax04919   Thyroid hormone signaling pathway btax04921   Oxytocin signaling pathway btax04926   Relaxin signaling pathway btax04929   GnRH secretion btax04933   AGE-RAGE signaling pathway in diabetic complications btax04935   Growth hormone synthesis, secretion and action btax05010   Alzheimer disease btax05022   Pathways of neurodegeneration - multiple diseases btax05034   Alcoholism btax05160   Hepatitis C btax05161   Hepatitis B btax05163   Human cytomegalovirus infection btax05165   Human papillomavirus infection btax05166   Human T-cell leukemia virus 1 infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05170   Human immunodeficiency virus 1 infection btax05200   Pathways in cancer btax05203   Viral carcinogenesis btax05205   Proteoglycans in cancer btax05206   MicroRNAs in cancer btax05207   Chemical carcinogenesis - receptor activation btax05208   Chemical carcinogenesis - reactive oxygen species btax05210   Colorectal cancer btax05211   Renal cell carcinoma btax05213   Endometrial cancer btax05214   Glioma btax05215   Prostate cancer btax05216   Thyroid cancer btax05218   Melanoma btax05219   Bladder cancer btax05220   Chronic myeloid leukemia btax05221   Acute myeloid leukemia btax05223   Non-small cell lung cancer btax05224   Breast cancer btax05225   Hepatocellular carcinoma btax05226   Gastric cancer btax05230   Central carbon metabolism in cancer btax05231   Choline metabolism in cancer btax05235   PD-L1 expression and PD-1 checkpoint pathway in cancer btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128044537 (NRAS)    04012 ErbB signaling pathway     128044537 (NRAS)    04014 Ras signaling pathway     128044537 (NRAS)    04015 Rap1 signaling pathway     128044537 (NRAS)    04370 VEGF signaling pathway     128044537 (NRAS)    04371 Apelin signaling pathway     128044537 (NRAS)    04068 FoxO signaling pathway     128044537 (NRAS)    04072 Phospholipase D signaling pathway     128044537 (NRAS)    04071 Sphingolipid signaling pathway     128044537 (NRAS)    04151 PI3K-Akt signaling pathway     128044537 (NRAS)    04150 mTOR signaling pathway     128044537 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128044537 (NRAS)    04137 Mitophagy - animal     128044537 (NRAS)   09143 Cell growth and death    04210 Apoptosis     128044537 (NRAS)    04218 Cellular senescence     128044537 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     128044537 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     128044537 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128044537 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128044537 (NRAS)    04650 Natural killer cell mediated cytotoxicity     128044537 (NRAS)    04660 T cell receptor signaling pathway     128044537 (NRAS)    04662 B cell receptor signaling pathway     128044537 (NRAS)    04664 Fc epsilon RI signaling pathway     128044537 (NRAS)    04062 Chemokine signaling pathway     128044537 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     128044537 (NRAS)    04929 GnRH secretion     128044537 (NRAS)    04912 GnRH signaling pathway     128044537 (NRAS)    04915 Estrogen signaling pathway     128044537 (NRAS)    04917 Prolactin signaling pathway     128044537 (NRAS)    04921 Oxytocin signaling pathway     128044537 (NRAS)    04926 Relaxin signaling pathway     128044537 (NRAS)    04935 Growth hormone synthesis, secretion and action     128044537 (NRAS)    04919 Thyroid hormone signaling pathway     128044537 (NRAS)    04916 Melanogenesis     128044537 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     128044537 (NRAS)    04726 Serotonergic synapse     128044537 (NRAS)    04720 Long-term potentiation     128044537 (NRAS)    04730 Long-term depression     128044537 (NRAS)    04722 Neurotrophin signaling pathway     128044537 (NRAS)   09158 Development and regeneration    04360 Axon guidance     128044537 (NRAS)   09149 Aging    04211 Longevity regulating pathway     128044537 (NRAS)    04213 Longevity regulating pathway - multiple species     128044537 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     128044537 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128044537 (NRAS)    05206 MicroRNAs in cancer     128044537 (NRAS)    05205 Proteoglycans in cancer     128044537 (NRAS)    05207 Chemical carcinogenesis - receptor activation     128044537 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     128044537 (NRAS)    05203 Viral carcinogenesis     128044537 (NRAS)    05230 Central carbon metabolism in cancer     128044537 (NRAS)    05231 Choline metabolism in cancer     128044537 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     128044537 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     128044537 (NRAS)    05225 Hepatocellular carcinoma     128044537 (NRAS)    05226 Gastric cancer     128044537 (NRAS)    05214 Glioma     128044537 (NRAS)    05216 Thyroid cancer     128044537 (NRAS)    05221 Acute myeloid leukemia     128044537 (NRAS)    05220 Chronic myeloid leukemia     128044537 (NRAS)    05218 Melanoma     128044537 (NRAS)    05211 Renal cell carcinoma     128044537 (NRAS)    05219 Bladder cancer     128044537 (NRAS)    05215 Prostate cancer     128044537 (NRAS)    05213 Endometrial cancer     128044537 (NRAS)    05224 Breast cancer     128044537 (NRAS)    05223 Non-small cell lung cancer     128044537 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128044537 (NRAS)    05170 Human immunodeficiency virus 1 infection     128044537 (NRAS)    05161 Hepatitis B     128044537 (NRAS)    05160 Hepatitis C     128044537 (NRAS)    05163 Human cytomegalovirus infection     128044537 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     128044537 (NRAS)    05165 Human papillomavirus infection     128044537 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     128044537 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     128044537 (NRAS)   09165 Substance dependence    05034 Alcoholism     128044537 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128044537 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     128044537 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     128044537 (NRAS)    01522 Endocrine resistance     128044537 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128044537 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128044537 (NRAS)    04031 GTP-binding proteins [BR:btax04031]     128044537 (NRAS) Membrane trafficking [BR:btax04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128044537 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128044537 (NRAS) Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128044537 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    128044537 (NRAS)   Exosomal proteins of breast cancer cells    128044537 (NRAS)   Exosomal proteins of colorectal cancer cells    128044537 (NRAS) GTP-binding proteins [BR:btax04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128044537 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  128044537 NCBI-ProteinID:  XP_052492770 LinkDB All DBs Position 3:29003397..29013158 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTHG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgacttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagctatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggcactcacggt tgtatggggttgccatgtgtggtaatgtag

DBGET integrated database retrieval system