Budorcas taxicolor (takin): 128044866 Help Entry 128044866         CDS       T08909                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism btax  Budorcas taxicolor (takin) Pathway btax04382   Cornified envelope formation btax05132   Salmonella infection Brite KEGG Orthology (KO) [BR:btax00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128044866 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128044866 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128044866 (S100A10) Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of microglial cells    128044866 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  128044866 NCBI-ProteinID:  XP_052493244 LinkDB All DBs Position 3:19129877..19141241 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacatttcacaaatttgca ggtgataaaggttacttaacaaaagaagacctcagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctggac cagtgtcgagatggcaaagtgggcttccagagcttcttttcgctaatcgctgggctcacc atcgcatgcaatgactattttgtagtacacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system