Budorcas taxicolor (takin): 128045681 Help Entry 128045681         CDS       T08909                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism btax  Budorcas taxicolor (takin) Pathway btax04146   Peroxisome btax04213   Longevity regulating pathway - multiple species btax05012   Parkinson disease btax05014   Amyotrophic lateral sclerosis btax05016   Huntington disease btax05020   Prion disease btax05022   Pathways of neurodegeneration - multiple diseases btax05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:btax00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     128045681 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     128045681 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     128045681 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     128045681 (SOD1)    05014 Amyotrophic lateral sclerosis     128045681 (SOD1)    05016 Huntington disease     128045681 (SOD1)    05020 Prion disease     128045681 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     128045681 (SOD1) Enzymes [BR:btax01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      128045681 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  128045681 NCBI-ProteinID:  XP_052494092 LinkDB All DBs Position 1:complement(68537025..68545818) Genome browser AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVKADENGVATVDIVDALISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSRLACGVIGIAP NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggtgacggcccggtgcaaggcaccatccac ttcgaggcaaagggagataaagtcgtcgtaactggatccattacagggttgactgaaggt gatcacggattccacgtccatcagtttggagacaatacacaaggctgtaccagcgcaggt cctcactttaatcctctgtccaaaaaacacggtgggccaaaggatgaagagaggcatgtt ggagacctgggaaatgtgaaggctgacgaaaatggtgttgccactgtggatatcgtagat gccttgatctcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctgga agtcgtttggcctgtggtgtaattggaattgccccgtaa

DBGET integrated database retrieval system