Budorcas taxicolor (takin): 128048032 Help Entry 128048032         CDS       T08909                                  Symbol IGF1 Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism btax  Budorcas taxicolor (takin) Pathway btax01521   EGFR tyrosine kinase inhibitor resistance btax01522   Endocrine resistance btax04010   MAPK signaling pathway btax04014   Ras signaling pathway btax04015   Rap1 signaling pathway btax04066   HIF-1 signaling pathway btax04068   FoxO signaling pathway btax04081   Hormone signaling btax04114   Oocyte meiosis btax04115   p53 signaling pathway btax04150   mTOR signaling pathway btax04151   PI3K-Akt signaling pathway btax04152   AMPK signaling pathway btax04211   Longevity regulating pathway btax04213   Longevity regulating pathway - multiple species btax04510   Focal adhesion btax04550   Signaling pathways regulating pluripotency of stem cells btax04730   Long-term depression btax04750   Inflammatory mediator regulation of TRP channels btax04913   Ovarian steroidogenesis btax04914   Progesterone-mediated oocyte maturation btax04935   Growth hormone synthesis, secretion and action btax04960   Aldosterone-regulated sodium reabsorption btax05200   Pathways in cancer btax05202   Transcriptional misregulation in cancer btax05205   Proteoglycans in cancer btax05214   Glioma btax05215   Prostate cancer btax05218   Melanoma btax05224   Breast cancer btax05410   Hypertrophic cardiomyopathy btax05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128048032 (IGF1)    04014 Ras signaling pathway     128048032 (IGF1)    04015 Rap1 signaling pathway     128048032 (IGF1)    04066 HIF-1 signaling pathway     128048032 (IGF1)    04068 FoxO signaling pathway     128048032 (IGF1)    04151 PI3K-Akt signaling pathway     128048032 (IGF1)    04152 AMPK signaling pathway     128048032 (IGF1)    04150 mTOR signaling pathway     128048032 (IGF1)   09133 Signaling molecules and interaction    04081 Hormone signaling     128048032 (IGF1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     128048032 (IGF1)    04115 p53 signaling pathway     128048032 (IGF1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128048032 (IGF1)    04550 Signaling pathways regulating pluripotency of stem cells     128048032 (IGF1)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     128048032 (IGF1)    04914 Progesterone-mediated oocyte maturation     128048032 (IGF1)    04935 Growth hormone synthesis, secretion and action     128048032 (IGF1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     128048032 (IGF1)   09156 Nervous system    04730 Long-term depression     128048032 (IGF1)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     128048032 (IGF1)   09149 Aging    04211 Longevity regulating pathway     128048032 (IGF1)    04213 Longevity regulating pathway - multiple species     128048032 (IGF1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128048032 (IGF1)    05202 Transcriptional misregulation in cancer     128048032 (IGF1)    05205 Proteoglycans in cancer     128048032 (IGF1)   09162 Cancer: specific types    05214 Glioma     128048032 (IGF1)    05218 Melanoma     128048032 (IGF1)    05215 Prostate cancer     128048032 (IGF1)    05224 Breast cancer     128048032 (IGF1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     128048032 (IGF1)    05414 Dilated cardiomyopathy     128048032 (IGF1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     128048032 (IGF1)    01522 Endocrine resistance     128048032 (IGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128048032 (IGF1) Cytokines and neuropeptides [BR:btax04052]  Cytokines   Growth factors (RTK binding)    128048032 (IGF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  128048032 NCBI-ProteinID:  XP_052496445 LinkDB All DBs Position 5:complement(110047256..110118445) Genome browser AA seq 137 aa AA seqDB search MVTPTVKMPVTSSSHLFYLALCLLAFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKP TGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEV HLKNTSRGSAGNKNYRM NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggttacacctacagtgaagatgccagtcacatcctcctcgcatctcttctatctggcc ctgtgcttgctcgccttcaccagctctgccacggcgggacccgagaccctctgcggggct gagttggtggatgctctccagttcgtgtgtggagacaggggcttttatttcaacaagccc acggggtacggctcgagcagtcggagggcgccccagacaggaatcgtggatgagtgctgc ttccggagctgtgatctgaggaggctggagatgtactgtgcgcctctcaagcccgccaag tcggcccgctcagtgcgtgcccagcgccacaccgacatgcccaaggctcagaaggaagta catttgaagaacacaagtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system