Budorcas taxicolor (takin): 128050786 Help Entry 128050786         CDS       T08909                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism btax  Budorcas taxicolor (takin) Pathway btax04140   Autophagy - animal btax04144   Endocytosis btax04152   AMPK signaling pathway btax04530   Tight junction btax04972   Pancreatic secretion btax05014   Amyotrophic lateral sclerosis btax05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     128050786 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128050786 (RAB8A)    04140 Autophagy - animal     128050786 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     128050786 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     128050786 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     128050786 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     128050786 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128050786 (RAB8A)    03036 Chromosome and associated proteins [BR:btax03036]     128050786 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128050786 (RAB8A)    04031 GTP-binding proteins [BR:btax04031]     128050786 (RAB8A) Membrane trafficking [BR:btax04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     128050786 (RAB8A)  Autophagy   Other autophagy associated proteins     128050786 (RAB8A) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     128050786 (RAB8A) Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128050786 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    128050786 (RAB8A)   Exosomal proteins of colorectal cancer cells    128050786 (RAB8A) GTP-binding proteins [BR:btax04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     128050786 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 Motif Other DBs NCBI-GeneID:  128050786 NCBI-ProteinID:  XP_052499142 LinkDB All DBs Position 7:complement(8732835..8753279) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggagcggtttcggacgatcacgacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgataacatccgg aactggattcggaacattgaagagcacgcctctgcagatgtcgagaagatgatccttggg aacaagtgcgatgtgaacgacaagagacaggtgtccaaggagcggggagaaaagctggcc ctggactatggaatcaagttcatggagacaagcgcaaaggccaacatcaacgtggagaac gcattttacactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccaaggagtcaaaatcaccccagaccagcagaagaggagcagc ttcttccgatgtgttcttctgtga

DBGET integrated database retrieval system