Budorcas taxicolor (takin): 128051473 Help Entry 128051473         CDS       T08909                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism btax  Budorcas taxicolor (takin) Pathway btax04015   Rap1 signaling pathway btax04810   Regulation of actin cytoskeleton btax05014   Amyotrophic lateral sclerosis btax05132   Salmonella infection Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     128051473  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128051473  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128051473   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     128051473  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128051473   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:btax04812]     128051473    04147 Exosome [BR:btax04147]     128051473 Membrane trafficking [BR:btax04131]  Others   Actin-binding proteins    Others     128051473 Cytoskeleton proteins [BR:btax04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      128051473 Exosome [BR:btax04147]  Exosomal proteins   Proteins found in most exosomes    128051473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  128051473 NCBI-ProteinID:  XP_052500027 LinkDB All DBs Position 7:62803099..62803576 Genome browser AA seq 128 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIMGHKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFL VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTKIAKTLVLLMGKECPR RYDQQEML NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctgggtggaacgcctacatcgacaatctcatggcggacgggacctgtcaagacgca gccatcatgggccataaggactcgccctccgtctgggccgccgtccccggcaagaccttc gtcaacatcacgcctgctgaggtcggtatcctagttggcaaagaccggtcaagttttctc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggagaatttactatggatcttcgtaccaagagcaccggtggagccccaactttcaac atcactgtcaccaagattgccaagacgctagtcctgctgatgggcaaagagtgtccacgg cggtatgatcaacaagaaatgttatga

DBGET integrated database retrieval system