Budorcas taxicolor (takin): 128051718 Help Entry 128051718         CDS       T08909                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism btax  Budorcas taxicolor (takin) Pathway btax04015   Rap1 signaling pathway btax04810   Regulation of actin cytoskeleton btax05014   Amyotrophic lateral sclerosis btax05132   Salmonella infection Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     128051718 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128051718 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128051718 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     128051718 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128051718 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:btax04812]     128051718 (PFN3)    04147 Exosome [BR:btax04147]     128051718 (PFN3) Membrane trafficking [BR:btax04131]  Others   Actin-binding proteins    Others     128051718 (PFN3) Cytoskeleton proteins [BR:btax04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      128051718 (PFN3) Exosome [BR:btax04147]  Exosomal proteins   Proteins found in most exosomes    128051718 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  128051718 NCBI-ProteinID:  XP_052500316 LinkDB All DBs Position 7:complement(38786501..38786914) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRAQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgatgacgtg gccatcgtgggccactcggacaatcgttgcgtgtgggcctcgcggcctgggggcctgctg gcggccatctcaccgcaggaagtcggtgtgctcaccgggccagaccggagcaccttcctg caggcggggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggcc gagggagacggagtgctggacgcgcgcacgaagggtctggacgggcgcgccatctgcgtg ggccacacgcctcgggcgctcctcgtgctcatgggccggcggggcgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgcgcgcagggcacctag

DBGET integrated database retrieval system