Budorcas taxicolor (takin): 128052362 Help Entry 128052362         CDS       T08909                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism btax  Budorcas taxicolor (takin) Pathway btax03030   DNA replication btax03082   ATP-dependent chromatin remodeling btax03410   Base excision repair btax03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:btax00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     128052362 (POLE3)    03410 Base excision repair     128052362 (POLE3)    03420 Nucleotide excision repair     128052362 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128052362 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:btax03032]     128052362 (POLE3)    03036 Chromosome and associated proteins [BR:btax03036]     128052362 (POLE3)    03400 DNA repair and recombination proteins [BR:btax03400]     128052362 (POLE3) Enzymes [BR:btax01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      128052362 (POLE3) DNA replication proteins [BR:btax03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     128052362 (POLE3) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     128052362 (POLE3) DNA repair and recombination proteins [BR:btax03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       128052362 (POLE3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 CIS_TMP DUF5427 SpoU_methylase DUF4746 TAF Myc_N RNA_pol_3_Rpc31 Pox_Ag35 CDC45 DDHD DUF6080 V_ATPase_I NOA36 Motif Other DBs NCBI-GeneID:  128052362 NCBI-ProteinID:  XP_052500857 LinkDB All DBs Position 8:complement(105965416..105968074) Genome browser AA seq 147 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD KSRDEDNDEDEERLEEEEQNEEEEVDN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggagaggcccgaggacctaaacctgcccaatgccgtcatcaccagaatcatcaag gaggcgctcccggacggtgtcaacatctccaaggaggcccggagcgccatctcccgcgcc gccagcgtcttcgtgctgtacgccacatcctgtgccaacaactttgcgatgaaagggaaa cgcaagacactgaatgccagcgatgtgctgtcagccatggaggagatggagtttcagcgg ttcgttaccccattaaaggaagctctggaagcttataggagggagcagaaaggcaagaag gaagcttcagagcaaaagaagaaggacaaagacaaaaaaacagattcggaagagcaggac aagagcagggatgaggacaatgatgaagatgaggaaaggctggaggaagaagaacagaat gaagaggaggaagtggacaactga

DBGET integrated database retrieval system