Budorcas taxicolor (takin): 128052431 Help Entry 128052431         CDS       T08909                                  Name (RefSeq) interferon alpha-H   KO K05414   interferon alpha Organism btax  Budorcas taxicolor (takin) Pathway btax04060   Cytokine-cytokine receptor interaction btax04151   PI3K-Akt signaling pathway btax04217   Necroptosis btax04620   Toll-like receptor signaling pathway btax04621   NOD-like receptor signaling pathway btax04622   RIG-I-like receptor signaling pathway btax04623   Cytosolic DNA-sensing pathway btax04630   JAK-STAT signaling pathway btax04650   Natural killer cell mediated cytotoxicity btax04936   Alcoholic liver disease btax05152   Tuberculosis btax05160   Hepatitis C btax05161   Hepatitis B btax05162   Measles btax05163   Human cytomegalovirus infection btax05164   Influenza A btax05165   Human papillomavirus infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05168   Herpes simplex virus 1 infection btax05169   Epstein-Barr virus infection btax05170   Human immunodeficiency virus 1 infection btax05171   Coronavirus disease - COVID-19 btax05200   Pathways in cancer btax05320   Autoimmune thyroid disease btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     128052431    04151 PI3K-Akt signaling pathway     128052431   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128052431  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128052431  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128052431    04621 NOD-like receptor signaling pathway     128052431    04622 RIG-I-like receptor signaling pathway     128052431    04623 Cytosolic DNA-sensing pathway     128052431    04650 Natural killer cell mediated cytotoxicity     128052431  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128052431   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     128052431    05161 Hepatitis B     128052431    05160 Hepatitis C     128052431    05171 Coronavirus disease - COVID-19     128052431    05164 Influenza A     128052431    05162 Measles     128052431    05168 Herpes simplex virus 1 infection     128052431    05163 Human cytomegalovirus infection     128052431    05167 Kaposi sarcoma-associated herpesvirus infection     128052431    05169 Epstein-Barr virus infection     128052431    05165 Human papillomavirus infection     128052431   09171 Infectious disease: bacterial    05152 Tuberculosis     128052431   09163 Immune disease    05320 Autoimmune thyroid disease     128052431   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128052431   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     128052431  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128052431 Cytokines and neuropeptides [BR:btax04052]  Cytokines   Interferons    128052431 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  128052431 NCBI-ProteinID:  XP_052500951 LinkDB All DBs Position 8:26285999..26286568 Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSRGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRKDFA FPQEVLGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRNKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctcggggatgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttcgca ttcccccaggaggtgctgggtggtagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcatgg gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ctgcaggagagattcaggaacaaggactga

DBGET integrated database retrieval system