Budorcas taxicolor (takin): 128052502 Help Entry 128052502         CDS       T08909                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism btax  Budorcas taxicolor (takin) Pathway btax04621   NOD-like receptor signaling pathway btax05012   Parkinson disease btax05132   Salmonella infection btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     128052502 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128052502 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     128052502 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     128052502 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:btax03110]     128052502 (TXN) Chaperones and folding catalysts [BR:btax03110]  Protein folding catalysts   Protein disulfide isomerase    128052502 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  128052502 NCBI-ProteinID:  XP_052501036 LinkDB All DBs Position 8:complement(103155006..103166940) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtatgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattctctctctgagaagtattccaacgtggtgttcctcgaagtagatgtggat gactgtcaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaaaggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system