Budorcas taxicolor (takin): 128053330 Help Entry 128053330         CDS       T08909                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism btax  Budorcas taxicolor (takin) Pathway btax04145   Phagocytosis btax04814   Motor proteins btax05132   Salmonella infection Brite KEGG Orthology (KO) [BR:btax00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     128053330 (DYNLT1)   09142 Cell motility    04814 Motor proteins     128053330 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128053330 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:btax03037]     128053330 (DYNLT1)    04812 Cytoskeleton proteins [BR:btax04812]     128053330 (DYNLT1) Cilium and associated proteins [BR:btax03037]  Motile cilia and associated proteins   Dynein arm    128053330 (DYNLT1) Cytoskeleton proteins [BR:btax04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      128053330 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  128053330 NCBI-ProteinID:  XP_052501795 LinkDB All DBs Position 9 Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggccgccgaggagactgcttttgttgttgatgaagtgagcaacatc gtaaaggaggccatagaaagtgccatcggtggcaacgcctatcagcacagcaaagtcaat cagtggaccacaaacgtagtggaacagaccttaagccagctcaccaagctggggaagcca tttaagtacatcgtgacctgtgtgatcatgcagaagaatggagcgggcctgcacacggca agctcatgcttctgggacagctccactgacgggagctgcaccgtgcgctgggagaacaag accatgtactgcatcgtcagcgccttcggactgtccatctga

DBGET integrated database retrieval system