Budorcas taxicolor (takin): 128055318 Help Entry 128055318         CDS       T08909                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism btax  Budorcas taxicolor (takin) Pathway btax04010   MAPK signaling pathway btax04020   Calcium signaling pathway btax04022   cGMP-PKG signaling pathway btax04114   Oocyte meiosis btax04218   Cellular senescence btax04310   Wnt signaling pathway btax04360   Axon guidance btax04370   VEGF signaling pathway btax04380   Osteoclast differentiation btax04625   C-type lectin receptor signaling pathway btax04650   Natural killer cell mediated cytotoxicity btax04658   Th1 and Th2 cell differentiation btax04659   Th17 cell differentiation btax04660   T cell receptor signaling pathway btax04662   B cell receptor signaling pathway btax04720   Long-term potentiation btax04724   Glutamatergic synapse btax04921   Oxytocin signaling pathway btax04922   Glucagon signaling pathway btax04924   Renin secretion btax05010   Alzheimer disease btax05014   Amyotrophic lateral sclerosis btax05020   Prion disease btax05022   Pathways of neurodegeneration - multiple diseases btax05031   Amphetamine addiction btax05152   Tuberculosis btax05163   Human cytomegalovirus infection btax05166   Human T-cell leukemia virus 1 infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05170   Human immunodeficiency virus 1 infection btax05235   PD-L1 expression and PD-1 checkpoint pathway in cancer btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128055318 (PPP3R1)    04310 Wnt signaling pathway     128055318 (PPP3R1)    04370 VEGF signaling pathway     128055318 (PPP3R1)    04020 Calcium signaling pathway     128055318 (PPP3R1)    04022 cGMP-PKG signaling pathway     128055318 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     128055318 (PPP3R1)    04218 Cellular senescence     128055318 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128055318 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     128055318 (PPP3R1)    04660 T cell receptor signaling pathway     128055318 (PPP3R1)    04658 Th1 and Th2 cell differentiation     128055318 (PPP3R1)    04659 Th17 cell differentiation     128055318 (PPP3R1)    04662 B cell receptor signaling pathway     128055318 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     128055318 (PPP3R1)    04921 Oxytocin signaling pathway     128055318 (PPP3R1)    04924 Renin secretion     128055318 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     128055318 (PPP3R1)    04720 Long-term potentiation     128055318 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     128055318 (PPP3R1)    04380 Osteoclast differentiation     128055318 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     128055318 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128055318 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     128055318 (PPP3R1)    05163 Human cytomegalovirus infection     128055318 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     128055318 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     128055318 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     128055318 (PPP3R1)    05014 Amyotrophic lateral sclerosis     128055318 (PPP3R1)    05020 Prion disease     128055318 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     128055318 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     128055318 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128055318 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:btax01009]     128055318 (PPP3R1) Protein phosphatases and associated proteins [BR:btax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      128055318 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  128055318 NCBI-ProteinID:  XP_052503780 LinkDB All DBs Position 11:complement(126052835..126115513) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctacctgagttacaacagaatcccctggtacagcgagtaatagat atattcgacaccgatgggaatggagaagtagactttaaagagttcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagacggctatatttccaatggggaactcttccaggtgctaaagatgatggtg gggaacaatctgaaagacacacagttacagcaaatcgtagacaaaaccataataaatgca gataaggatggggatggaagaatatcctttgaagaattctgtgctgttgtaggcggccta gatatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system