Budorcas taxicolor (takin): 128056109 Help Entry 128056109         CDS       T08909                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism btax  Budorcas taxicolor (takin) Pathway btax04024   cAMP signaling pathway btax04080   Neuroactive ligand-receptor interaction btax04081   Hormone signaling btax04935   Growth hormone synthesis, secretion and action btax04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     128056109 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     128056109 (SST)    04081 Hormone signaling     128056109 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     128056109 (SST)   09154 Digestive system    04971 Gastric acid secretion     128056109 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128056109 (SST) Cytokines and neuropeptides [BR:btax04052]  Neuropeptides   GPCR binding    128056109 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  128056109 NCBI-ProteinID:  XP_052504757 LinkDB All DBs Position 1:144114825..144115991 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgctgctggcaaacaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system