Budorcas taxicolor (takin): 128056158 Help Entry 128056158         CDS       T08909                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism btax  Budorcas taxicolor (takin) Pathway btax03008   Ribosome biogenesis in eukaryotes btax03083   Polycomb repressive complex btax04064   NF-kappa B signaling pathway btax04137   Mitophagy - animal btax04310   Wnt signaling pathway btax04520   Adherens junction btax05010   Alzheimer disease btax05020   Prion disease btax05022   Pathways of neurodegeneration - multiple diseases btax05162   Measles btax05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:btax00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     128056158 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     128056158 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128056158 (CSNK2B)    04064 NF-kappa B signaling pathway     128056158 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     128056158 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     128056158 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     128056158 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     128056158 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     128056158 (CSNK2B)    05020 Prion disease     128056158 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     128056158 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:btax03009]     128056158 (CSNK2B)    03036 Chromosome and associated proteins [BR:btax03036]     128056158 (CSNK2B) Ribosome biogenesis [BR:btax03009]  Eukaryotic type   90S particles    Kinase     128056158 (CSNK2B) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      128056158 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  128056158 NCBI-ProteinID:  XP_052504804 LinkDB All DBs Position 11 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa tttttctgtgaggtggatgaagactatatccaggacaaattcaatctcactggactcaat gaacaggtgcctcactatcgacaagctttagacatgatcttggacctggagcctgatgag gagctggaagacaaccccaaccagagtgacctgattgagcaagcagccgaaatgctctat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggatactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagaggcccgcc aaccagtttgtgcccaggctttacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtgaagacgattcgctga

DBGET integrated database retrieval system