Budorcas taxicolor (takin): 128056679 Help Entry 128056679         CDS       T08909                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism btax  Budorcas taxicolor (takin) Pathway btax04010   MAPK signaling pathway btax04060   Cytokine-cytokine receptor interaction btax04217   Necroptosis btax04218   Cellular senescence btax04380   Osteoclast differentiation btax04640   Hematopoietic cell lineage btax04932   Non-alcoholic fatty liver disease btax04933   AGE-RAGE signaling pathway in diabetic complications btax04940   Type I diabetes mellitus btax05010   Alzheimer disease btax05020   Prion disease btax05022   Pathways of neurodegeneration - multiple diseases btax05133   Pertussis btax05140   Leishmaniasis btax05152   Tuberculosis btax05162   Measles btax05164   Influenza A btax05321   Inflammatory bowel disease btax05323   Rheumatoid arthritis btax05332   Graft-versus-host disease btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128056679 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128056679 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128056679 (IL1A)    04218 Cellular senescence     128056679 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     128056679 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     128056679 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     128056679 (IL1A)    05162 Measles     128056679 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     128056679 (IL1A)    05152 Tuberculosis     128056679 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     128056679 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     128056679 (IL1A)    05321 Inflammatory bowel disease     128056679 (IL1A)    05332 Graft-versus-host disease     128056679 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     128056679 (IL1A)    05020 Prion disease     128056679 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     128056679 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     128056679 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     128056679 (IL1A)    04932 Non-alcoholic fatty liver disease     128056679 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     128056679 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128056679 (IL1A) Cytokines and neuropeptides [BR:btax04052]  Cytokines   Interleukins    128056679 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 DUF4937 DUF6108 Motif Other DBs NCBI-GeneID:  128056679 NCBI-ProteinID:  XP_052505453 LinkDB All DBs Position 11:complement(105953481..105962904) Genome browser AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLREDHMNKFMSLDTSEIS KTSRLSFKENVVMVTANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSAHYSFQS NVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTAATLNNLEEAVKFDMVAYISEEDSQL PVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK LFIATKQEKLVHMASGPPSITDFQILEK NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac tatagttctgaaattgaccacctctctctgaatcagaagtccttctatgatgcaagctat gagccacttcgtgaggaccacatgaataagtttatgtccctggatacctcggaaatctct aagacatccaggcttagcttcaaggagaatgtggtgatggtgacagccaatgggaagatt ctgaagaagagacggttgagtttaaatcagttcatcaccgatgatgacctggaagccatt gccaatgataccgaagaagaaatcatcaagcccagatcagcacattacagcttccagagt aacgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc aatcaaagtataattcgagatatgtcaggtccatacctgacggctgctacattaaataat ctggaggaggcagtgaaatttgacatggttgcttatatatcagaagaggattctcagctt cctgtgactctaagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa cccgtcttgctaaaggagatgcctgagacacccaaaatcatcaaagatgagaccaatctc ctcttcttctgggaaaagcatggctctatggactacttcaaatcagttgcccatccaaag ctgtttattgccacaaagcaagaaaaactggtgcacatggcaagcgggccgccctcgatc actgactttcagatactggaaaaatag

DBGET integrated database retrieval system