Budorcas taxicolor (takin): 128057499 Help Entry 128057499         CDS       T08909                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism btax  Budorcas taxicolor (takin) Pathway btax03410   Base excision repair btax04140   Autophagy - animal btax04217   Necroptosis btax04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:btax00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     128057499 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128057499 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     128057499 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     128057499 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btax03036]     128057499 (HMGB1)    03400 DNA repair and recombination proteins [BR:btax03400]     128057499 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128057499 (HMGB1) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     128057499 (HMGB1) DNA repair and recombination proteins [BR:btax03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      128057499 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      128057499 (HMGB1) Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    128057499 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  128057499 NCBI-ProteinID:  XP_052505882 LinkDB All DBs Position 12:30366094..30371296 Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccggatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggcaaaggctgacaaggcccgttatgaaagagaaatgaaaacttatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcaccgaagaggcctccttca gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggcgaacatcctggcctg tccattggtgatgttgcaaagaaactgggagaaatgtggaataacactgctgcggatgac aagcagccttatgagaagaaggctgctaagctgaaggaaaaatatgaaaaggatattgct gcataccgagctaaagggaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaagaa gaagatgaagaggatgaggaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system