Budorcas taxicolor (takin): 128058230 Help Entry 128058230         CDS       T08909                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism btax  Budorcas taxicolor (takin) Pathway btax04014   Ras signaling pathway btax04015   Rap1 signaling pathway btax04020   Calcium signaling pathway btax04022   cGMP-PKG signaling pathway btax04024   cAMP signaling pathway btax04070   Phosphatidylinositol signaling system btax04114   Oocyte meiosis btax04218   Cellular senescence btax04261   Adrenergic signaling in cardiomyocytes btax04270   Vascular smooth muscle contraction btax04371   Apelin signaling pathway btax04625   C-type lectin receptor signaling pathway btax04713   Circadian entrainment btax04720   Long-term potentiation btax04722   Neurotrophin signaling pathway btax04728   Dopaminergic synapse btax04740   Olfactory transduction btax04744   Phototransduction btax04750   Inflammatory mediator regulation of TRP channels btax04910   Insulin signaling pathway btax04912   GnRH signaling pathway btax04915   Estrogen signaling pathway btax04916   Melanogenesis btax04921   Oxytocin signaling pathway btax04922   Glucagon signaling pathway btax04924   Renin secretion btax04925   Aldosterone synthesis and secretion btax04970   Salivary secretion btax04971   Gastric acid secretion btax05010   Alzheimer disease btax05012   Parkinson disease btax05022   Pathways of neurodegeneration - multiple diseases btax05031   Amphetamine addiction btax05034   Alcoholism btax05133   Pertussis btax05152   Tuberculosis btax05163   Human cytomegalovirus infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05170   Human immunodeficiency virus 1 infection btax05200   Pathways in cancer btax05214   Glioma btax05417   Lipid and atherosclerosis btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     128058230    04015 Rap1 signaling pathway     128058230    04371 Apelin signaling pathway     128058230    04020 Calcium signaling pathway     128058230    04070 Phosphatidylinositol signaling system     128058230    04024 cAMP signaling pathway     128058230    04022 cGMP-PKG signaling pathway     128058230  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     128058230    04218 Cellular senescence     128058230  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128058230   09152 Endocrine system    04910 Insulin signaling pathway     128058230    04922 Glucagon signaling pathway     128058230    04912 GnRH signaling pathway     128058230    04915 Estrogen signaling pathway     128058230    04921 Oxytocin signaling pathway     128058230    04916 Melanogenesis     128058230    04924 Renin secretion     128058230    04925 Aldosterone synthesis and secretion     128058230   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     128058230    04270 Vascular smooth muscle contraction     128058230   09154 Digestive system    04970 Salivary secretion     128058230    04971 Gastric acid secretion     128058230   09156 Nervous system    04728 Dopaminergic synapse     128058230    04720 Long-term potentiation     128058230    04722 Neurotrophin signaling pathway     128058230   09157 Sensory system    04744 Phototransduction     128058230    04740 Olfactory transduction     128058230    04750 Inflammatory mediator regulation of TRP channels     128058230   09159 Environmental adaptation    04713 Circadian entrainment     128058230  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128058230   09162 Cancer: specific types    05214 Glioma     128058230   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     128058230    05163 Human cytomegalovirus infection     128058230    05167 Kaposi sarcoma-associated herpesvirus infection     128058230   09171 Infectious disease: bacterial    05133 Pertussis     128058230    05152 Tuberculosis     128058230   09164 Neurodegenerative disease    05010 Alzheimer disease     128058230    05012 Parkinson disease     128058230    05022 Pathways of neurodegeneration - multiple diseases     128058230   09165 Substance dependence    05031 Amphetamine addiction     128058230    05034 Alcoholism     128058230   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128058230    05418 Fluid shear stress and atherosclerosis     128058230  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:btax01009]     128058230   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128058230    03036 Chromosome and associated proteins [BR:btax03036]     128058230   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128058230 Protein phosphatases and associated proteins [BR:btax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      128058230 Membrane trafficking [BR:btax04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     128058230 Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      128058230 Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    128058230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580_M Caleosin EF-hand_11 MTIP_N Dockerin_1 SurA_N_2 ExbD MmeI_hel Motif Other DBs NCBI-GeneID:  128058230 NCBI-ProteinID:  XP_052506579 LinkDB All DBs Position 13:42976492..42976941 Genome browser AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKEAFDKFDKDKDGTISVQELGTVMQELGLKPSEAELKVLIARLDTDN NGIISFQEFLEAMAAGLQTSDTEEDLREIFRAFDQDNDGYISVDELRQATAQLGEKLSQD ELDAMIREADVDQDGRVNYEEFVRILTQN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtctgaagagcaggtggcggagttcaaggaggccttcgacaagttc gacaaggacaaggatggcaccatcagtgtgcaggagctgggcaccgtgatgcaggagctg ggcctgaagccatcagaggctgagctgaaggtgctcatcgcccggctggacacagacaac aacggcatcatcagcttccaggagtttctggaggccatggccgcagggcttcagacctca gacacggaggaggacctgagggaaatcttccgtgccttcgaccaggacaacgatggctac atcagcgtggacgagctcaggcaggccacagcccagctgggggagaagctgtctcaggat gagctggatgccatgatccgggaggcagacgtggaccaagatggccgggtgaactatgag gagttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system