Budorcas taxicolor (takin): 128058470 Help Entry 128058470         CDS       T08909                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism btax  Budorcas taxicolor (takin) Pathway btax01521   EGFR tyrosine kinase inhibitor resistance btax01524   Platinum drug resistance btax04014   Ras signaling pathway btax04064   NF-kappa B signaling pathway btax04115   p53 signaling pathway btax04137   Mitophagy - animal btax04140   Autophagy - animal btax04151   PI3K-Akt signaling pathway btax04210   Apoptosis btax04215   Apoptosis - multiple species btax04621   NOD-like receptor signaling pathway btax04630   JAK-STAT signaling pathway btax05012   Parkinson disease btax05014   Amyotrophic lateral sclerosis btax05022   Pathways of neurodegeneration - multiple diseases btax05145   Toxoplasmosis btax05162   Measles btax05166   Human T-cell leukemia virus 1 infection btax05168   Herpes simplex virus 1 infection btax05170   Human immunodeficiency virus 1 infection btax05200   Pathways in cancer btax05202   Transcriptional misregulation in cancer btax05212   Pancreatic cancer btax05220   Chronic myeloid leukemia btax05222   Small cell lung cancer btax05225   Hepatocellular carcinoma btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     128058470 (BCL2L1)    04630 JAK-STAT signaling pathway     128058470 (BCL2L1)    04064 NF-kappa B signaling pathway     128058470 (BCL2L1)    04151 PI3K-Akt signaling pathway     128058470 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128058470 (BCL2L1)    04137 Mitophagy - animal     128058470 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     128058470 (BCL2L1)    04215 Apoptosis - multiple species     128058470 (BCL2L1)    04115 p53 signaling pathway     128058470 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     128058470 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128058470 (BCL2L1)    05202 Transcriptional misregulation in cancer     128058470 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     128058470 (BCL2L1)    05225 Hepatocellular carcinoma     128058470 (BCL2L1)    05220 Chronic myeloid leukemia     128058470 (BCL2L1)    05222 Small cell lung cancer     128058470 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128058470 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     128058470 (BCL2L1)    05162 Measles     128058470 (BCL2L1)    05168 Herpes simplex virus 1 infection     128058470 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     128058470 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     128058470 (BCL2L1)    05014 Amyotrophic lateral sclerosis     128058470 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     128058470 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128058470 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     128058470 (BCL2L1)    01524 Platinum drug resistance     128058470 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:btax01009]     128058470 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btax03036]     128058470 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:btax02000]     128058470 (BCL2L1) Protein phosphatases and associated proteins [BR:btax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      128058470 (BCL2L1) Chromosome and associated proteins [BR:btax03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     128058470 (BCL2L1) Transporters [BR:btax02000]  Other transporters   Pores ion channels [TC:1]    128058470 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  128058470 NCBI-ProteinID:  XP_052506911 LinkDB All DBs Position 13:complement(61007860..61059378) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcttacaagctttcccagaag ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaagga acagaatcagatatggaaacccccagtgccatcaatggcaacccatcttggcacctggcg gatagccctgcggtgaatggagccactggccacagcagaagcttggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcgttcagcgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgaacaagtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacgtttgtggaactctacgggaacaacgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system