Budorcas taxicolor (takin): 128058481 Help Entry 128058481         CDS       T08909                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism btax  Budorcas taxicolor (takin) Pathway btax03010   Ribosome btax04120   Ubiquitin mediated proteolysis btax04137   Mitophagy - animal btax04140   Autophagy - animal btax05012   Parkinson disease btax05022   Pathways of neurodegeneration - multiple diseases btax05167   Kaposi sarcoma-associated herpesvirus infection btax05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:btax00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     128058481   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128058481  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128058481    04137 Mitophagy - animal     128058481  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     128058481    05167 Kaposi sarcoma-associated herpesvirus infection     128058481   09164 Neurodegenerative disease    05012 Parkinson disease     128058481    05022 Pathways of neurodegeneration - multiple diseases     128058481  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:btax03011]     128058481    04121 Ubiquitin system [BR:btax04121]     128058481 Ribosome [BR:btax03011]  Ribosomal proteins   Eukaryotes    Large subunit     128058481   Archaea     128058481 Ubiquitin system [BR:btax04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    128058481 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 DUF2604 TBK1_ULD Ubiquitin_5 Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  128058481 NCBI-ProteinID:  XP_052506923 LinkDB All DBs Position 13:complement(50302640..50303042) Genome browser AA seq 126 aa AA seqDB search MQIFVKTLMGKTITLEVEPSDTTESVKAKIQDEEGIPPDQQRLIFSGKELEDGRTLSDYN IQKESTLHLALHLRGGIIEPSLRQLGQKYNCDKMICPKCYARLHPRAVNCRKKYGHTNNL RPKKVK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctgatgggcaagaccattacccttgaggtcgagcccagt gacaccactgagagtgtcaaagccaaaatccaagacgaggagggcatcccaccagaccag cagcgtctgatcttctccggcaaagagctggaggatggccgcactctgtcagactacaat atccagaaagagtccaccctgcacctggcgcttcatctgcgaggcggcatcattgagcct tccctccgtcagctcggtcagaaatacaactgtgacaagatgatctgccccaagtgttac gcccgcctgcacccccgtgctgtcaactgccgcaagaagtacggccacaccaacaacctg cgccccaagaaggtcaaataa

DBGET integrated database retrieval system