KEGG   Budorcas taxicolor (takin): 128062160
Entry
128062160         CDS       T08909                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
btax  Budorcas taxicolor (takin)
Pathway
btax01521  EGFR tyrosine kinase inhibitor resistance
btax01522  Endocrine resistance
btax01524  Platinum drug resistance
btax04010  MAPK signaling pathway
btax04012  ErbB signaling pathway
btax04014  Ras signaling pathway
btax04015  Rap1 signaling pathway
btax04022  cGMP-PKG signaling pathway
btax04024  cAMP signaling pathway
btax04062  Chemokine signaling pathway
btax04066  HIF-1 signaling pathway
btax04068  FoxO signaling pathway
btax04071  Sphingolipid signaling pathway
btax04072  Phospholipase D signaling pathway
btax04114  Oocyte meiosis
btax04140  Autophagy - animal
btax04148  Efferocytosis
btax04150  mTOR signaling pathway
btax04151  PI3K-Akt signaling pathway
btax04210  Apoptosis
btax04218  Cellular senescence
btax04261  Adrenergic signaling in cardiomyocytes
btax04270  Vascular smooth muscle contraction
btax04350  TGF-beta signaling pathway
btax04360  Axon guidance
btax04370  VEGF signaling pathway
btax04371  Apelin signaling pathway
btax04380  Osteoclast differentiation
btax04510  Focal adhesion
btax04520  Adherens junction
btax04540  Gap junction
btax04550  Signaling pathways regulating pluripotency of stem cells
btax04611  Platelet activation
btax04613  Neutrophil extracellular trap formation
btax04620  Toll-like receptor signaling pathway
btax04621  NOD-like receptor signaling pathway
btax04625  C-type lectin receptor signaling pathway
btax04650  Natural killer cell mediated cytotoxicity
btax04657  IL-17 signaling pathway
btax04658  Th1 and Th2 cell differentiation
btax04659  Th17 cell differentiation
btax04660  T cell receptor signaling pathway
btax04662  B cell receptor signaling pathway
btax04664  Fc epsilon RI signaling pathway
btax04666  Fc gamma R-mediated phagocytosis
btax04668  TNF signaling pathway
btax04713  Circadian entrainment
btax04720  Long-term potentiation
btax04722  Neurotrophin signaling pathway
btax04723  Retrograde endocannabinoid signaling
btax04724  Glutamatergic synapse
btax04725  Cholinergic synapse
btax04726  Serotonergic synapse
btax04730  Long-term depression
btax04810  Regulation of actin cytoskeleton
btax04910  Insulin signaling pathway
btax04912  GnRH signaling pathway
btax04914  Progesterone-mediated oocyte maturation
btax04915  Estrogen signaling pathway
btax04916  Melanogenesis
btax04917  Prolactin signaling pathway
btax04919  Thyroid hormone signaling pathway
btax04921  Oxytocin signaling pathway
btax04926  Relaxin signaling pathway
btax04928  Parathyroid hormone synthesis, secretion and action
btax04929  GnRH secretion
btax04930  Type II diabetes mellitus
btax04933  AGE-RAGE signaling pathway in diabetic complications
btax04934  Cushing syndrome
btax04935  Growth hormone synthesis, secretion and action
btax04960  Aldosterone-regulated sodium reabsorption
btax05010  Alzheimer disease
btax05020  Prion disease
btax05022  Pathways of neurodegeneration - multiple diseases
btax05034  Alcoholism
btax05132  Salmonella infection
btax05133  Pertussis
btax05135  Yersinia infection
btax05140  Leishmaniasis
btax05142  Chagas disease
btax05145  Toxoplasmosis
btax05152  Tuberculosis
btax05160  Hepatitis C
btax05161  Hepatitis B
btax05163  Human cytomegalovirus infection
btax05164  Influenza A
btax05165  Human papillomavirus infection
btax05166  Human T-cell leukemia virus 1 infection
btax05167  Kaposi sarcoma-associated herpesvirus infection
btax05170  Human immunodeficiency virus 1 infection
btax05171  Coronavirus disease - COVID-19
btax05200  Pathways in cancer
btax05203  Viral carcinogenesis
btax05205  Proteoglycans in cancer
btax05206  MicroRNAs in cancer
btax05207  Chemical carcinogenesis - receptor activation
btax05208  Chemical carcinogenesis - reactive oxygen species
btax05210  Colorectal cancer
btax05211  Renal cell carcinoma
btax05212  Pancreatic cancer
btax05213  Endometrial cancer
btax05214  Glioma
btax05215  Prostate cancer
btax05216  Thyroid cancer
btax05218  Melanoma
btax05219  Bladder cancer
btax05220  Chronic myeloid leukemia
btax05221  Acute myeloid leukemia
btax05223  Non-small cell lung cancer
btax05224  Breast cancer
btax05225  Hepatocellular carcinoma
btax05226  Gastric cancer
btax05230  Central carbon metabolism in cancer
btax05231  Choline metabolism in cancer
btax05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
btax05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:btax00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    128062160 (MAPK1)
   04012 ErbB signaling pathway
    128062160 (MAPK1)
   04014 Ras signaling pathway
    128062160 (MAPK1)
   04015 Rap1 signaling pathway
    128062160 (MAPK1)
   04350 TGF-beta signaling pathway
    128062160 (MAPK1)
   04370 VEGF signaling pathway
    128062160 (MAPK1)
   04371 Apelin signaling pathway
    128062160 (MAPK1)
   04668 TNF signaling pathway
    128062160 (MAPK1)
   04066 HIF-1 signaling pathway
    128062160 (MAPK1)
   04068 FoxO signaling pathway
    128062160 (MAPK1)
   04072 Phospholipase D signaling pathway
    128062160 (MAPK1)
   04071 Sphingolipid signaling pathway
    128062160 (MAPK1)
   04024 cAMP signaling pathway
    128062160 (MAPK1)
   04022 cGMP-PKG signaling pathway
    128062160 (MAPK1)
   04151 PI3K-Akt signaling pathway
    128062160 (MAPK1)
   04150 mTOR signaling pathway
    128062160 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    128062160 (MAPK1)
   04148 Efferocytosis
    128062160 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    128062160 (MAPK1)
   04210 Apoptosis
    128062160 (MAPK1)
   04218 Cellular senescence
    128062160 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    128062160 (MAPK1)
   04520 Adherens junction
    128062160 (MAPK1)
   04540 Gap junction
    128062160 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    128062160 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    128062160 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    128062160 (MAPK1)
   04613 Neutrophil extracellular trap formation
    128062160 (MAPK1)
   04620 Toll-like receptor signaling pathway
    128062160 (MAPK1)
   04621 NOD-like receptor signaling pathway
    128062160 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    128062160 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    128062160 (MAPK1)
   04660 T cell receptor signaling pathway
    128062160 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    128062160 (MAPK1)
   04659 Th17 cell differentiation
    128062160 (MAPK1)
   04657 IL-17 signaling pathway
    128062160 (MAPK1)
   04662 B cell receptor signaling pathway
    128062160 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    128062160 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    128062160 (MAPK1)
   04062 Chemokine signaling pathway
    128062160 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    128062160 (MAPK1)
   04929 GnRH secretion
    128062160 (MAPK1)
   04912 GnRH signaling pathway
    128062160 (MAPK1)
   04915 Estrogen signaling pathway
    128062160 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    128062160 (MAPK1)
   04917 Prolactin signaling pathway
    128062160 (MAPK1)
   04921 Oxytocin signaling pathway
    128062160 (MAPK1)
   04926 Relaxin signaling pathway
    128062160 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    128062160 (MAPK1)
   04919 Thyroid hormone signaling pathway
    128062160 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    128062160 (MAPK1)
   04916 Melanogenesis
    128062160 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    128062160 (MAPK1)
   04270 Vascular smooth muscle contraction
    128062160 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    128062160 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    128062160 (MAPK1)
   04725 Cholinergic synapse
    128062160 (MAPK1)
   04726 Serotonergic synapse
    128062160 (MAPK1)
   04720 Long-term potentiation
    128062160 (MAPK1)
   04730 Long-term depression
    128062160 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    128062160 (MAPK1)
   04722 Neurotrophin signaling pathway
    128062160 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    128062160 (MAPK1)
   04380 Osteoclast differentiation
    128062160 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    128062160 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    128062160 (MAPK1)
   05206 MicroRNAs in cancer
    128062160 (MAPK1)
   05205 Proteoglycans in cancer
    128062160 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    128062160 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    128062160 (MAPK1)
   05203 Viral carcinogenesis
    128062160 (MAPK1)
   05230 Central carbon metabolism in cancer
    128062160 (MAPK1)
   05231 Choline metabolism in cancer
    128062160 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    128062160 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    128062160 (MAPK1)
   05212 Pancreatic cancer
    128062160 (MAPK1)
   05225 Hepatocellular carcinoma
    128062160 (MAPK1)
   05226 Gastric cancer
    128062160 (MAPK1)
   05214 Glioma
    128062160 (MAPK1)
   05216 Thyroid cancer
    128062160 (MAPK1)
   05221 Acute myeloid leukemia
    128062160 (MAPK1)
   05220 Chronic myeloid leukemia
    128062160 (MAPK1)
   05218 Melanoma
    128062160 (MAPK1)
   05211 Renal cell carcinoma
    128062160 (MAPK1)
   05219 Bladder cancer
    128062160 (MAPK1)
   05215 Prostate cancer
    128062160 (MAPK1)
   05213 Endometrial cancer
    128062160 (MAPK1)
   05224 Breast cancer
    128062160 (MAPK1)
   05223 Non-small cell lung cancer
    128062160 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    128062160 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    128062160 (MAPK1)
   05161 Hepatitis B
    128062160 (MAPK1)
   05160 Hepatitis C
    128062160 (MAPK1)
   05171 Coronavirus disease - COVID-19
    128062160 (MAPK1)
   05164 Influenza A
    128062160 (MAPK1)
   05163 Human cytomegalovirus infection
    128062160 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    128062160 (MAPK1)
   05165 Human papillomavirus infection
    128062160 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    128062160 (MAPK1)
   05135 Yersinia infection
    128062160 (MAPK1)
   05133 Pertussis
    128062160 (MAPK1)
   05152 Tuberculosis
    128062160 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    128062160 (MAPK1)
   05140 Leishmaniasis
    128062160 (MAPK1)
   05142 Chagas disease
    128062160 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    128062160 (MAPK1)
   05020 Prion disease
    128062160 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    128062160 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    128062160 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    128062160 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    128062160 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    128062160 (MAPK1)
   04934 Cushing syndrome
    128062160 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    128062160 (MAPK1)
   01524 Platinum drug resistance
    128062160 (MAPK1)
   01522 Endocrine resistance
    128062160 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btax01001]
    128062160 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:btax03036]
    128062160 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btax04147]
    128062160 (MAPK1)
Enzymes [BR:btax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     128062160 (MAPK1)
Protein kinases [BR:btax01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   128062160 (MAPK1)
Chromosome and associated proteins [BR:btax03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     128062160 (MAPK1)
Exosome [BR:btax04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128062160 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 128062160
NCBI-ProteinID: XP_052510468
LinkDB
Position
17:71988760..72042820
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag
caccagacgtactgccagaggacgctgagagagataaagatcttgctgcgcttcagacac
gagaacatcattggaatcaacgacatcattcgggcgccgaccatcgagcagatgaaagac
gtatacatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaatgaccacatctgctactttctttaccagatcctcagagggctgaagtatatc
cattcagccaacgtgctgcaccgggacctcaagccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcctggcccgtgttgcagatccggaccacgaccac
acagggttcctgaccgagtacgtggccacgcgctggtaccgggctccagagatcatgctg
aactccaagggctacaccaagtccatcgacatctggtccgtgggctgcatcctagcagag
atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccgtcgcaggaagacctgaattgtataataaatttaaaagct
agaaactatctgctctctcttccacacaaaaataaggtgccgtggaacaggctgttcccg
aatgctgactccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag
aggatcgaggtggagcaggctctggcccatccatacctggagcagtactacgatccaagc
gacgagcccgtcgccgaagcacctttcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccgggataccgatct
taa

DBGET integrated database retrieval system