Budorcas taxicolor (takin): 128062529 Help Entry 128062529         CDS       T08909                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism btax  Budorcas taxicolor (takin) Pathway btax04060   Cytokine-cytokine receptor interaction btax04061   Viral protein interaction with cytokine and cytokine receptor btax04151   PI3K-Akt signaling pathway btax04625   C-type lectin receptor signaling pathway btax04630   JAK-STAT signaling pathway btax04658   Th1 and Th2 cell differentiation btax04659   Th17 cell differentiation btax04660   T cell receptor signaling pathway btax04672   Intestinal immune network for IgA production btax04940   Type I diabetes mellitus btax05135   Yersinia infection btax05142   Chagas disease btax05162   Measles btax05166   Human T-cell leukemia virus 1 infection btax05171   Coronavirus disease - COVID-19 btax05200   Pathways in cancer btax05320   Autoimmune thyroid disease btax05321   Inflammatory bowel disease btax05330   Allograft rejection btax05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     128062529 (IL2)    04151 PI3K-Akt signaling pathway     128062529 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128062529 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     128062529 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128062529 (IL2)    04660 T cell receptor signaling pathway     128062529 (IL2)    04658 Th1 and Th2 cell differentiation     128062529 (IL2)    04659 Th17 cell differentiation     128062529 (IL2)    04672 Intestinal immune network for IgA production     128062529 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128062529 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128062529 (IL2)    05171 Coronavirus disease - COVID-19     128062529 (IL2)    05162 Measles     128062529 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     128062529 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     128062529 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     128062529 (IL2)    05321 Inflammatory bowel disease     128062529 (IL2)    05330 Allograft rejection     128062529 (IL2)    05332 Graft-versus-host disease     128062529 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     128062529 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128062529 (IL2)    00536 Glycosaminoglycan binding proteins [BR:btax00536]     128062529 (IL2) Cytokines and neuropeptides [BR:btax04052]  Cytokines   Interleukins    128062529 (IL2) Glycosaminoglycan binding proteins [BR:btax00536]  Heparan sulfate / Heparin   Cytokines    128062529 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Zw10_N Motif Other DBs NCBI-GeneID:  128062529 NCBI-ProteinID:  XP_052510979 LinkDB All DBs Position 17:35606698..35611202 Genome browser AA seq 155 aa AA seqDB search MYKIQLLSCIALTLALIANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH TFNFYMPKVNATELKHLKCLLEELKLLEEVLDLAPSKNLNTREIKDSMDNIKRIVLELQG SETRFTCEYDDATVKAVEFLNKWITFCQSIYSTMT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcattgcaaacggt gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat ttacagttgcttttggagaaagttaaaaatcccgagaacctcaagctctccaggatgcat acatttaacttctacatgcccaaggttaacgctacagaattgaaacatcttaagtgttta ctagaagaactcaaacttctagaggaagtgctagatttagctccaagcaaaaacctgaac accagagagatcaaggattcaatggacaatatcaagagaatagttttggaactacaggga tctgaaacaagattcacatgtgaatatgatgatgcgacagtaaaggctgtagaatttctg aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system