Budorcas taxicolor (takin): 128063078 Help Entry 128063078         CDS       T08909                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism btax  Budorcas taxicolor (takin) Pathway btax04010   MAPK signaling pathway btax04014   Ras signaling pathway btax04015   Rap1 signaling pathway btax04024   cAMP signaling pathway btax04072   Phospholipase D signaling pathway btax04137   Mitophagy - animal btax04140   Autophagy - animal btax04218   Cellular senescence btax04360   Axon guidance btax04371   Apelin signaling pathway btax04519   Cadherin signaling btax04625   C-type lectin receptor signaling pathway btax04810   Regulation of actin cytoskeleton btax05132   Salmonella infection btax05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128063078 (RRAS)    04014 Ras signaling pathway     128063078 (RRAS)    04015 Rap1 signaling pathway     128063078 (RRAS)    04371 Apelin signaling pathway     128063078 (RRAS)    04072 Phospholipase D signaling pathway     128063078 (RRAS)    04024 cAMP signaling pathway     128063078 (RRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     128063078 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128063078 (RRAS)    04137 Mitophagy - animal     128063078 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     128063078 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128063078 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128063078 (RRAS)   09158 Development and regeneration    04360 Axon guidance     128063078 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     128063078 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     128063078 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:btax04031]     128063078 (RRAS) GTP-binding proteins [BR:btax04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128063078 (RRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  128063078 NCBI-ProteinID:  XP_052511601 LinkDB All DBs Position 18 Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSLPSAPRKKARGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactacgacccc actattgaagactcctacacgaagatctgcactgtggatggcgtcccagcccggctagac atcctggacactgccggccaggaggagtttggtgccatgcgggaacagtacatgcgtgcg ggccacggcttcctgctggtgtttgccattaatgacaggcagagtttcaacgaagtgggc aagctcttcacgcagatccttcgagtcaaggaccgagacgacttccccatcgtgttggtt ggcaacaaggcggatctggaaacacagcgccaggtcccccgatctgaagcctccaccttc agtgcctcccaccacgtggcctactttgaagcttctgccaaactgcgcctcaacgtggat gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc tccctgcccagcgcccccaggaagaaggccagaggctgcccctgtgtccttctgtag

DBGET integrated database retrieval system