Budorcas taxicolor (takin): 128064137 Help Entry 128064137         CDS       T08909                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism btax  Budorcas taxicolor (takin) Pathway btax04060   Cytokine-cytokine receptor interaction btax04061   Viral protein interaction with cytokine and cytokine receptor btax04062   Chemokine signaling pathway btax04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128064137 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     128064137 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128064137 (CCL22)    04062 Chemokine signaling pathway     128064137 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:btax04052]     128064137 (CCL22) Cytokines and neuropeptides [BR:btax04052]  Cytokines   Chemokines    128064137 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  128064137 NCBI-ProteinID:  XP_052512887 LinkDB All DBs Position 18:26998361..27004426 Genome browser AA seq 93 aa AA seqDB search MASLQTPLLAALILLAMTLQATEAGPYGANVEDSVCCRDYIRYPLPLRLVKYYYWTSNSC RRPGVVLLTVKDREICADPKQHWVKKILQKLNQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagacccctctcctggctgctctcatcctcctggctatgacacttcaa gcaacagaggcaggcccctacggtgccaacgtggaggacagcgtctgttgccgggactac atccgttaccctctgcccctgcgtttggtgaaatattactactggacttcaaattcctgc cggaggcctggcgtggtcttgctgactgtgaaggaccgagagatctgtgctgaccccaaa cagcactgggtgaagaagattctccagaagctgaaccaatga

DBGET integrated database retrieval system