Budorcas taxicolor (takin): 128066553 Help Entry 128066553         CDS       T08909                                  Symbol CFL2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism btax  Budorcas taxicolor (takin) Pathway btax04360   Axon guidance btax04666   Fc gamma R-mediated phagocytosis btax04810   Regulation of actin cytoskeleton btax05133   Pertussis btax05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:btax00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128066553 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     128066553 (CFL2)   09158 Development and regeneration    04360 Axon guidance     128066553 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     128066553 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     128066553 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128066553 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:btax04812]     128066553 (CFL2)    04147 Exosome [BR:btax04147]     128066553 (CFL2) Membrane trafficking [BR:btax04131]  Others   Actin-binding proteins    Others     128066553 (CFL2) Cytoskeleton proteins [BR:btax04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      128066553 (CFL2) Exosome [BR:btax04147]  Exosomal proteins   Proteins found in most exosomes    128066553 (CFL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  128066553 NCBI-ProteinID:  XP_052515546 LinkDB All DBs Position 21:complement(48974990..48977741) Genome browser AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta aggaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgaaagtgcgcctttaaaaagcaagatgatatatgctagctct aaagatgccattaaaaagaaatttacaggtataaaacatgagtggcaagtaaatggcttg gatgacataaaggaccgttccacacttggagagaaattgggaggcaacgtagtagtttca cttgaaggaaaacccttataa

DBGET integrated database retrieval system