Budorcas taxicolor (takin): 128066643 Help Entry 128066643         CDS       T08909                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism btax  Budorcas taxicolor (takin) Pathway btax04024   cAMP signaling pathway btax04062   Chemokine signaling pathway btax04064   NF-kappa B signaling pathway btax04210   Apoptosis btax04380   Osteoclast differentiation btax04620   Toll-like receptor signaling pathway btax04621   NOD-like receptor signaling pathway btax04622   RIG-I-like receptor signaling pathway btax04623   Cytosolic DNA-sensing pathway btax04625   C-type lectin receptor signaling pathway btax04657   IL-17 signaling pathway btax04658   Th1 and Th2 cell differentiation btax04659   Th17 cell differentiation btax04660   T cell receptor signaling pathway btax04662   B cell receptor signaling pathway btax04668   TNF signaling pathway btax04722   Neurotrophin signaling pathway btax04920   Adipocytokine signaling pathway btax04926   Relaxin signaling pathway btax04931   Insulin resistance btax04936   Alcoholic liver disease btax05132   Salmonella infection btax05134   Legionellosis btax05135   Yersinia infection btax05140   Leishmaniasis btax05142   Chagas disease btax05145   Toxoplasmosis btax05160   Hepatitis C btax05161   Hepatitis B btax05162   Measles btax05163   Human cytomegalovirus infection btax05164   Influenza A btax05166   Human T-cell leukemia virus 1 infection btax05167   Kaposi sarcoma-associated herpesvirus infection btax05168   Herpes simplex virus 1 infection btax05169   Epstein-Barr virus infection btax05170   Human immunodeficiency virus 1 infection btax05171   Coronavirus disease - COVID-19 btax05200   Pathways in cancer btax05203   Viral carcinogenesis btax05208   Chemical carcinogenesis - reactive oxygen species btax05215   Prostate cancer btax05220   Chronic myeloid leukemia btax05222   Small cell lung cancer btax05235   PD-L1 expression and PD-1 checkpoint pathway in cancer btax05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     128066643 (NFKBIA)    04668 TNF signaling pathway     128066643 (NFKBIA)    04024 cAMP signaling pathway     128066643 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     128066643 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128066643 (NFKBIA)    04621 NOD-like receptor signaling pathway     128066643 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     128066643 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     128066643 (NFKBIA)    04625 C-type lectin receptor signaling pathway     128066643 (NFKBIA)    04660 T cell receptor signaling pathway     128066643 (NFKBIA)    04658 Th1 and Th2 cell differentiation     128066643 (NFKBIA)    04659 Th17 cell differentiation     128066643 (NFKBIA)    04657 IL-17 signaling pathway     128066643 (NFKBIA)    04662 B cell receptor signaling pathway     128066643 (NFKBIA)    04062 Chemokine signaling pathway     128066643 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     128066643 (NFKBIA)    04926 Relaxin signaling pathway     128066643 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     128066643 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     128066643 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128066643 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     128066643 (NFKBIA)    05203 Viral carcinogenesis     128066643 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     128066643 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     128066643 (NFKBIA)    05215 Prostate cancer     128066643 (NFKBIA)    05222 Small cell lung cancer     128066643 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     128066643 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     128066643 (NFKBIA)    05161 Hepatitis B     128066643 (NFKBIA)    05160 Hepatitis C     128066643 (NFKBIA)    05171 Coronavirus disease - COVID-19     128066643 (NFKBIA)    05164 Influenza A     128066643 (NFKBIA)    05162 Measles     128066643 (NFKBIA)    05168 Herpes simplex virus 1 infection     128066643 (NFKBIA)    05163 Human cytomegalovirus infection     128066643 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     128066643 (NFKBIA)    05169 Epstein-Barr virus infection     128066643 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     128066643 (NFKBIA)    05135 Yersinia infection     128066643 (NFKBIA)    05134 Legionellosis     128066643 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     128066643 (NFKBIA)    05140 Leishmaniasis     128066643 (NFKBIA)    05142 Chagas disease     128066643 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128066643 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     128066643 (NFKBIA)    04931 Insulin resistance     128066643 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:btax03000]     128066643 (NFKBIA)    04131 Membrane trafficking [BR:btax04131]     128066643 (NFKBIA) Transcription factors [BR:btax03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     128066643 (NFKBIA) Membrane trafficking [BR:btax04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     128066643 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  128066643 NCBI-ProteinID:  XP_052515684 LinkDB All DBs Position 21:complement(49512972..49516343) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQQLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagaggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcgctcaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccggggaacccagcagctccactccattctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtagag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctgttgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccttagagaaccttcagacactg ccagagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system