Bartonella taylorii: LAJ60_00300 Help Entry LAJ60_00300       CDS       T08323                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism btay  Bartonella taylorii Pathway btay01100   Metabolic pathways btay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LAJ60_00300    00074 Mycolic acid biosynthesis     LAJ60_00300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LAJ60_00300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  USP02946 UniProt:  A0A9Q8YYL4 LinkDB All DBs Position 69825..70061 Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVENASFIDDLGADSLDTVELVMAFEEEFGVEIPDEAA ETIFTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaagaaaattatcgtggagcatcttggtgttaatgca gataaggtagtggaaaatgcaagctttatcgatgatctaggagcagatagccttgatacg gttgagctcgttatggcttttgaagaagaatttggtgtagaaatcccagatgaggctgct gaaacaattttcacagttggtgatgccgtaaagtttatcgataaagcttctgcgtga

DBGET integrated database retrieval system