Bacillus thuringiensis BMB171: BMB171_C1768 Help Entry BMB171_C1768      CDS       T01239                                  Symbol asbD Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism btb  Bacillus thuringiensis BMB171 Pathway btb00975   Biosynthesis of various siderophores btb01100   Metabolic pathways btb01110   Biosynthesis of secondary metabolites Module btb_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:btb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BMB171_C1768 (asbD)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btb01008]     BMB171_C1768 (asbD) Polyketide biosynthesis proteins [BR:btb01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BMB171_C1768 (asbD) SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  ADH06583 LinkDB All DBs Position 1892289..1892564 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMIEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELEPLQEVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgccgtgttaaaaattatgatagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgcttaaatcaagatttatatatagattcg gtaatgatgttacagcttattgtatacatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaggcatttcttactgtaggatctttgcttgattttatggaagag ttagagccgttacaggaagtaaatgtgaataactaa

DBGET integrated database retrieval system