Burkholderia thailandensis E264: BTH_I1720 Help Entry BTH_I1720         CDS       T00311                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bte  Burkholderia thailandensis E264 Pathway bte00998   Biosynthesis of various antibiotics bte01100   Metabolic pathways bte01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bte00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTH_I1720 (acpP)    00074 Mycolic acid biosynthesis     BTH_I1720 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTH_I1720 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABC37460 UniProt:  Q2SXU4 LinkDB All DBs Position I:1929286..1929525 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgagcaactgggcgtcgccgaa gctgaaatcaagaacgaagcgtcgttcgtgaatgacctcggcgcggactcgctcgacacg gtcgagctcgtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaagcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system