Burkholderia thailandensis E264: BTH_I3155 Help Entry BTH_I3155         CDS       T00311                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bte  Burkholderia thailandensis E264 Brite KEGG Orthology (KO) [BR:bte00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bte03036]     BTH_I3155    03400 DNA repair and recombination proteins [BR:bte03400]     BTH_I3155 Chromosome and associated proteins [BR:bte03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTH_I3155 DNA repair and recombination proteins [BR:bte03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTH_I3155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Topoisom_I_N Motif Other DBs NCBI-ProteinID:  ABC39269 UniProt:  Q2STV0 LinkDB All DBs Position I:complement(3597667..3597960) Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgctcagcgagagaagctggagaagcagatcgaagag gccaagtcgcgcgaatacgcggaggtattgagcgacgtcaagcaaaagatcgccgattac ggtttcacgctcgcagaactcggtctcggtcgtggcaaagctggaaaggcgggtcggccc cgcgccggtgtcgcggcgaagtaccgcgatccggaatccggcgcgacctggtcgggccgt gggaagcctcctcgctggattgcgggcaagaaccgcgaacaattcgcaatctga

DBGET integrated database retrieval system