Burkholderia thailandensis E264: BTH_I3189 Help Entry BTH_I3189         CDS       T00311                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bte  Burkholderia thailandensis E264 Brite KEGG Orthology (KO) [BR:bte00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bte03036]     BTH_I3189    03400 DNA repair and recombination proteins [BR:bte03400]     BTH_I3189 Chromosome and associated proteins [BR:bte03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTH_I3189 DNA repair and recombination proteins [BR:bte03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTH_I3189 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS ROS_MUCR Rootletin Motif Other DBs NCBI-ProteinID:  ABC37692 UniProt:  Q2STR6 LinkDB All DBs Position I:complement(3635953..3636249) Genome browser AA seq 98 aa AA seqDB search MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQDLGFAERARRGRPPK KGPLPPKYRDPKSGSTWSGRGKPPQWIVGKNRDRFLIG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaaatcaaggcgcagatcgtcgagcttcaggcccaggccgaagag gtgcgtcgtcaggagatcgcggccgtggtcgccgagctgcaaggcaagatcgccgagtat gggctcacggcgcaagacctgggatttgccgagcgcgcgcggcgtggccgtccgccgaag aaggggccgctgcccccgaagtaccgcgatccgaaatccggcagtacgtggagcggccgc gggaaaccgccgcaatggatcgtcggcaaaaaccgcgatcgctttttgatcggctga

DBGET integrated database retrieval system