Burkholderia thailandensis E264: BTH_II0088 Help Entry BTH_II0088        CDS       T00311                                  Name (GenBank) DNA-binding protein BprA   KO K03746   DNA-binding protein H-NS Organism bte  Burkholderia thailandensis E264 Brite KEGG Orthology (KO) [BR:bte00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bte03036]     BTH_II0088    03400 DNA repair and recombination proteins [BR:bte03400]     BTH_II0088 Chromosome and associated proteins [BR:bte03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTH_II0088 DNA repair and recombination proteins [BR:bte03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTH_II0088 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ABC34291 UniProt:  Q2STN1 LinkDB All DBs Position II:97053..97358 Genome browser AA seq 101 aa AA seqDB search MATYEELKAQLDALNKEAEAAKAREISTALSQIRETILRYEIRPDQIFPQWTRLRSPDKR RGPLPPKYRNPMTGETWCGRGRAPKWMSGLPRVEFLIDRPA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt gtggcaacttatgaggaactgaaagctcaactcgatgcactcaataaggaggccgaagca gccaaagcgcgtgaaatctcgacggcgctgtctcagatccgggaaaccatcctgaggtac gaaattcgtcccgaccagatctttccgcaatggacgcgccttcgctcgccggacaagcgg cgtggtccactgcctccaaagtatcggaacccgatgactggggaaacctggtgcggtcga ggccgagcaccaaaatggatgtccgggttgccgcgcgtagaattccttatagatcgaccc gcctga

DBGET integrated database retrieval system