Burkholderia thailandensis E264: BTH_II0181 Help Entry BTH_II0181        CDS       T00311                                  Name (GenBank) conserved hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism bte  Burkholderia thailandensis E264 Pathway bte02020   Two-component system bte02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bte00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BTH_II0181  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BTH_II0181  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bte02035]     BTH_II0181 Bacterial motility proteins [BR:bte02035]  Flagellar system   Flagellar assembly proteins    Others     BTH_II0181 SSDB OrthologParalogGFIT Motif Pfam:  FlgM Rsa3 DUF6894 Motif Other DBs NCBI-ProteinID:  ABC35797 UniProt:  Q2T8W6 LinkDB All DBs Position II:215232..215516 Genome browser AA seq 94 aa AA seqDB search MKLSSTKYGVPAQRSNGASRASTTAQEGGARGAAAGDACLEVELLRPAQDVLRELPDFDA ARVAALRAALQEGRLPFDAGKLAGLIQRFHGAKE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaactgtccagtacgaaatatggcgtgcccgcgcaacgaagcaacggcgcgagccgt gcgtcgacgacagcgcaggaaggcggcgcgcgcggcgcggcagcgggcgatgcgtgtttg gaggtcgaactgttgcgacctgcgcaggacgtgctgcgcgagctgccggatttcgacgcg gcgcgcgtggcggcgttgcgcgcggcgctgcaggaggggcggctgccgttcgatgcgggc aagctggccggactgatccagcgttttcacggagcgaaggaatga

DBGET integrated database retrieval system