Burkholderia thailandensis E264: BTH_II0843 Help Entry BTH_II0843        CDS       T00311                                  Name (GenBank) DNA-binding protein BprA   KO K03746   DNA-binding protein H-NS Organism bte  Burkholderia thailandensis E264 Brite KEGG Orthology (KO) [BR:bte00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bte03036]     BTH_II0843    03400 DNA repair and recombination proteins [BR:bte03400]     BTH_II0843 Chromosome and associated proteins [BR:bte03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTH_II0843 DNA repair and recombination proteins [BR:bte03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTH_II0843 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  ABC35500 UniProt:  Q2T709 LinkDB All DBs Position II:984515..984805 Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAEAARQAELQAAIDEVRAKVREYGLTAYEVFGYRKKADERKRG AVRPKYRDPATGATWSGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggcccgggccgaggcgttgagcgcgcaggccgaagcg gcgcggcaggccgaattgcaggccgcgatcgatgaggtgcgcgcgaaggtgcgcgagtat ggtctcacggcatacgaagtgttcggataccgaaagaaggcagacgagcgaaagcgcggg gcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggagcgggcgcggcatc gagccgaaatggattcgcgggcgcaaccgggacgaattcctgatcgagtga

DBGET integrated database retrieval system